(data stored in ACNUC7421 zone)

EMBL: CP001349.PE398

CP001349.PE398       Location/Qualifiers
FT   CDS             complement(458853..460022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0408"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: met:M446_6098 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55450"
FT                   /db_xref="GOA:B8IB57"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB57"
FT                   /inference="protein motif:TFAM:TIGR00016"
FT                   /protein_id="ACL55450.1"
FT                   /translation="MSDAILAINAGSSSLKFALYAAGSLALLCRGGVSGLGGPVAVEAS
FT                   GPVPLATGAPPPAGSNHATAIAWLLDAVRRMPDLVLRAAGHRVVHGGRDYAAPVLIDGA
FT                   VLDALERLVPLAPAHQPHNLAAIRAVAAAWPNLPQVACFDTAFHRTQPRLAQLFPIPRA
FT                   LTDAGILRYGFHGLSYQHVAETLPEVAGERAEGRVIVAHLGHGASLCAMRARRSIASTM
FT                   GFTALDGLMMGTRSGAVDPGLVLHLIRERGLDPAAVADLLNNRSGLLGVSELSDDVRVL
FT                   QESGDPRAAEALDLFAYRAVREAGSLMAALGGLDLIVFTAGIGEHAPRVRAAIAAGLSF
FT                   AGVELDEERNAAGRGRISRDGSPVAVYVVPANEELPIARAAARLVLGAG"
     MSDAILAINA GSSSLKFALY AAGSLALLCR GGVSGLGGPV AVEASGPVPL ATGAPPPAGS        60
     NHATAIAWLL DAVRRMPDLV LRAAGHRVVH GGRDYAAPVL IDGAVLDALE RLVPLAPAHQ       120
     PHNLAAIRAV AAAWPNLPQV ACFDTAFHRT QPRLAQLFPI PRALTDAGIL RYGFHGLSYQ       180
     HVAETLPEVA GERAEGRVIV AHLGHGASLC AMRARRSIAS TMGFTALDGL MMGTRSGAVD       240
     PGLVLHLIRE RGLDPAAVAD LLNNRSGLLG VSELSDDVRV LQESGDPRAA EALDLFAYRA       300
     VREAGSLMAA LGGLDLIVFT AGIGEHAPRV RAAIAAGLSF AGVELDEERN AAGRGRISRD       360
     GSPVAVYVVP ANEELPIARA AARLVLGAG                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page