(data stored in ACNUC7421 zone)

EMBL: CP001349.PE399

CP001349.PE399       Location/Qualifiers
FT   CDS             complement(460019..461461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0409"
FT                   /product="MaoC domain protein dehydratase"
FT                   /EC_number="2.3.1.19"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; MaoC
FT                   domain protein dehydratase; KEGG: met:M446_6099 phosphate
FT                   butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55451"
FT                   /db_xref="GOA:B8IB58"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB58"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACL55451.1"
FT                   /translation="MEPLQYIENRTLAEIRVGDTASLTRTLKPQDISLFAVVSGEVNPA
FT                   HLDKDYAEADRFHGVIAHGLWGGSLISAVLGTELPGPGTIYLGQSLRFLRPVRVGDAIT
FT                   ARVTVREKDAARARLILDCTCLNAQGEAVITGEAEVLAPTEKVRRPRVLLPEVHLHERG
FT                   AQWRRLIAAAQGLAPIRTAVVHPCDAVSLRGALAGAQAGLIAPVLVGPRGKIAAAAEAA
FT                   GLSLDGLEIVDAPHSHAAAERAVALARAGTVAALMKGALHTDEILAAAVRKETGLRTER
FT                   RMSHVYALDVPHYPKPLFITDAAVNIAPTLEEKRDIVQNAIDLCRALGLAQPKAAILSA
FT                   VETVSMKLGSTLDAAALCKMAERGQITGGIVDGPLAFDNAVSREAAATKGLASAVAGDA
FT                   DILVAPDLVSGNMLAKQLIHLAGADAAGLILGARVPIILTSRSDSAEVREASCALAQLF
FT                   VHRAGAAAAPAGAAAGPVGAAV"
     MEPLQYIENR TLAEIRVGDT ASLTRTLKPQ DISLFAVVSG EVNPAHLDKD YAEADRFHGV        60
     IAHGLWGGSL ISAVLGTELP GPGTIYLGQS LRFLRPVRVG DAITARVTVR EKDAARARLI       120
     LDCTCLNAQG EAVITGEAEV LAPTEKVRRP RVLLPEVHLH ERGAQWRRLI AAAQGLAPIR       180
     TAVVHPCDAV SLRGALAGAQ AGLIAPVLVG PRGKIAAAAE AAGLSLDGLE IVDAPHSHAA       240
     AERAVALARA GTVAALMKGA LHTDEILAAA VRKETGLRTE RRMSHVYALD VPHYPKPLFI       300
     TDAAVNIAPT LEEKRDIVQN AIDLCRALGL AQPKAAILSA VETVSMKLGS TLDAAALCKM       360
     AERGQITGGI VDGPLAFDNA VSREAAATKG LASAVAGDAD ILVAPDLVSG NMLAKQLIHL       420
     AGADAAGLIL GARVPIILTS RSDSAEVREA SCALAQLFVH RAGAAAAPAG AAAGPVGAAV       480
//

If you have problems or comments...

PBIL Back to PBIL home page