(data stored in ACNUC7421 zone)

EMBL: CP001349.PE4

CP001349.PE4         Location/Qualifiers
FT   CDS             4708..6558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0005"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: met:M446_0004 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55056"
FT                   /db_xref="GOA:B8ISZ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ4"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ACL55056.1"
FT                   /translation="MTSRLDEARAALRTTFGYEDFRPGQAEVIGAVLAGRDVLAVMPTG
FT                   SGKSMTYQLPALVERSLTVVVSPLIALMHDQVQQMQGFGVAAATLNSTIDEATARAAWR
FT                   QIRAGDLRLLFVSPERLLMEGLIEALQSAGVRRLAVDEAHCVSQWGHDFRPEYRDLARA
FT                   REALGGVQTVALTATADTATRADISERLFPAGRKPEVFVHSFDRPNIRLTFAPKEHPTR
FT                   QISRFLRPRRAESGIVYCSSRKRTEQLAQLLQEEGVRALPYHAGLDQGTRMRNQDAFLQ
FT                   EDGIVMVATVAFGMGINKPDVRFVCHADMPSNVEGYYQEIGRAGRDGLPADTLTLYGLD
FT                   DMALRRRQIDEKDIPDERRRVERRKLEAMIALCEGATCRRQSLLAYFGEASGPCGRCDL
FT                   CRGGVSLVDGTVAAQKVLSAIVRTGQRFGAAYICDLVHGKETDQIRRNGHTRLRTFGVG
FT                   ADKPVAAWRSIMRQLFAAGAVAENQDGYGGLAMTDKGEAILFGRETVQLRPDPEPRPPK
FT                   ERRSRSAADHDDTLGLSPDDEALFQHLRGLRATLARQEGVAAYMIFPDRTLIEMARAKP
FT                   VDLWALRSVHGVGERKREAYGEAFVGTIADFLADAAKRAG"
     MTSRLDEARA ALRTTFGYED FRPGQAEVIG AVLAGRDVLA VMPTGSGKSM TYQLPALVER        60
     SLTVVVSPLI ALMHDQVQQM QGFGVAAATL NSTIDEATAR AAWRQIRAGD LRLLFVSPER       120
     LLMEGLIEAL QSAGVRRLAV DEAHCVSQWG HDFRPEYRDL ARAREALGGV QTVALTATAD       180
     TATRADISER LFPAGRKPEV FVHSFDRPNI RLTFAPKEHP TRQISRFLRP RRAESGIVYC       240
     SSRKRTEQLA QLLQEEGVRA LPYHAGLDQG TRMRNQDAFL QEDGIVMVAT VAFGMGINKP       300
     DVRFVCHADM PSNVEGYYQE IGRAGRDGLP ADTLTLYGLD DMALRRRQID EKDIPDERRR       360
     VERRKLEAMI ALCEGATCRR QSLLAYFGEA SGPCGRCDLC RGGVSLVDGT VAAQKVLSAI       420
     VRTGQRFGAA YICDLVHGKE TDQIRRNGHT RLRTFGVGAD KPVAAWRSIM RQLFAAGAVA       480
     ENQDGYGGLA MTDKGEAILF GRETVQLRPD PEPRPPKERR SRSAADHDDT LGLSPDDEAL       540
     FQHLRGLRAT LARQEGVAAY MIFPDRTLIE MARAKPVDLW ALRSVHGVGE RKREAYGEAF       600
     VGTIADFLAD AAKRAG                                                       616
//

If you have problems or comments...

PBIL Back to PBIL home page