(data stored in ACNUC7421 zone)

EMBL: CP001349.PE40

CP001349.PE40        Location/Qualifiers
FT   CDS             44173..44775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0041"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   met:M446_0040 3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55092"
FT                   /db_xref="GOA:B8IT30"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT30"
FT                   /inference="protein motif:TFAM:TIGR00171"
FT                   /protein_id="ACL55092.1"
FT                   /translation="MEKFTVLEGVAAPLRIVNVDTDRIIPKQYLKTIERTGLGKGLFSE
FT                   MRYRDDGSENPDFVLNQPAYRNAKILVAGDNFGCGSSREHAPWALADFGIRCIISTSFA
FT                   DIFFNNSAKNGILLITVSPEDLEKLFDDAERGANATLTVDLERQEIRGPDGGVLHFEID
FT                   PARKHNLLNGLDEIGLTLERAPAIEAYEAKLAERPWA"
     MEKFTVLEGV AAPLRIVNVD TDRIIPKQYL KTIERTGLGK GLFSEMRYRD DGSENPDFVL        60
     NQPAYRNAKI LVAGDNFGCG SSREHAPWAL ADFGIRCIIS TSFADIFFNN SAKNGILLIT       120
     VSPEDLEKLF DDAERGANAT LTVDLERQEI RGPDGGVLHF EIDPARKHNL LNGLDEIGLT       180
     LERAPAIEAY EAKLAERPWA                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page