(data stored in ACNUC7421 zone)

EMBL: CP001349.PE401

CP001349.PE401       Location/Qualifiers
FT   CDS             complement(461561..463441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0411"
FT                   /product="Poly-beta-hydroxybutyrate polymerase domain
FT                   protein"
FT                   /note="PFAM: alpha/beta hydrolase fold;
FT                   Poly-beta-hydroxybutyrate polymerase domain protein; KEGG:
FT                   met:M446_6101 poly-beta-hydroxybutyrate polymerase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55453"
FT                   /db_xref="GOA:B8IB60"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB60"
FT                   /inference="protein motif:PFAM:PF07167"
FT                   /protein_id="ACL55453.1"
FT                   /translation="MPATSIQMHPPDHVWPVQAATRPKPLAPTNDRRADPAPTNDRRAD
FT                   PALTDADRELLMTSEAIDLALHAAAARLTGGLSPAALANAWLDWGVHLAFSPGKQTELL
FT                   VKAARKSSRLSHFLLRTLMPPGRAEPCIAPLPQDHRFDDPAWQAWPFNLVYQSFLLNQQ
FT                   WWHNATTGVRGVSRAHENLVAFTARQMLDGVSPSNNPITNPVVLSETLRSGGANLVQGA
FT                   LNAMEDARRALAGSKPVGAEGFAVGREVAVTPGRVVYRNSLIELIQYAPTTQAVRPEPI
FT                   LIVPAWIMKYYILDLSPQNSLVRHLVGQGFSVFMISWRNPGPEDRNISFDDYRRLGIMA
FT                   ALDAIAAIVPDRPVHAAGYCLGGTLLSIAAAAMARDGDARLASLTLFAAQVDFTEAGEL
FT                   TLFINESEISFLESLMQSDGTLDAKQMAGAFQLLRSNDLIWSRMVNSYLLGRREAMTDL
FT                   MAWNADATRMPARMHAEYLRSLFHDNDLAEGRFAVGGRPVALTDIRAPVFAVGTERDHV
FT                   APWHSVFKLILLSDTEVTFLLASGGHNAGIVSEPGRPHRHFRVHTHRATDRYLDPETWL
FT                   QAARLEQGSWWPEWTAWLAARSGPPGPPPRMGASGSQDLGPAPGTYVREG"
     MPATSIQMHP PDHVWPVQAA TRPKPLAPTN DRRADPAPTN DRRADPALTD ADRELLMTSE        60
     AIDLALHAAA ARLTGGLSPA ALANAWLDWG VHLAFSPGKQ TELLVKAARK SSRLSHFLLR       120
     TLMPPGRAEP CIAPLPQDHR FDDPAWQAWP FNLVYQSFLL NQQWWHNATT GVRGVSRAHE       180
     NLVAFTARQM LDGVSPSNNP ITNPVVLSET LRSGGANLVQ GALNAMEDAR RALAGSKPVG       240
     AEGFAVGREV AVTPGRVVYR NSLIELIQYA PTTQAVRPEP ILIVPAWIMK YYILDLSPQN       300
     SLVRHLVGQG FSVFMISWRN PGPEDRNISF DDYRRLGIMA ALDAIAAIVP DRPVHAAGYC       360
     LGGTLLSIAA AAMARDGDAR LASLTLFAAQ VDFTEAGELT LFINESEISF LESLMQSDGT       420
     LDAKQMAGAF QLLRSNDLIW SRMVNSYLLG RREAMTDLMA WNADATRMPA RMHAEYLRSL       480
     FHDNDLAEGR FAVGGRPVAL TDIRAPVFAV GTERDHVAPW HSVFKLILLS DTEVTFLLAS       540
     GGHNAGIVSE PGRPHRHFRV HTHRATDRYL DPETWLQAAR LEQGSWWPEW TAWLAARSGP       600
     PGPPPRMGAS GSQDLGPAPG TYVREG                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page