(data stored in ACNUC7421 zone)

EMBL: CP001349.PE402

CP001349.PE402       Location/Qualifiers
FT   CDS             463630..463839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0412"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: met:M446_3573 TOBE
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55454"
FT                   /db_xref="GOA:B8IB61"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB61"
FT                   /inference="protein motif:PFAM:PF03459"
FT                   /protein_id="ACL55454.1"
FT                   /translation="MKISARNLLKGKVVSVEKGATTAHVKIEIAPGQVVTASITNESVD
FT                   SLKLAVGAEAYAVVKASDVMVAVD"
     MKISARNLLK GKVVSVEKGA TTAHVKIEIA PGQVVTASIT NESVDSLKLA VGAEAYAVVK        60
     ASDVMVAVD                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page