(data stored in ACNUC7421 zone)

EMBL: CP001349.PE403

CP001349.PE403       Location/Qualifiers
FT   CDS             complement(464290..465012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0413"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: regulatory
FT                   protein Crp; KEGG: met:M446_5720 Crp/FNR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55455"
FT                   /db_xref="GOA:B8IB62"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB62"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACL55455.1"
FT                   /translation="MVACRVNSLPPPRNLLLASLSPEDWSAVAPRLERVTLRPRQILEE
FT                   PRTEIRAVYFIERGFAAVQVRTQADGTHGVGLVGRFGMTGLSLLLGTRRAPFRISVQVA
FT                   GEAFRLDAAEAAALFAENTALRRLGLAYIQAVMVQGAQLSLCNARHSMKHRVRRWLLLA
FT                   QDWLGEPEIAVSHQLIAGLLGVRRASVSEQIERLEQAGIVRQQRASITVLCREALEQDS
FT                   CECHALISAEYRRLFTRR"
     MVACRVNSLP PPRNLLLASL SPEDWSAVAP RLERVTLRPR QILEEPRTEI RAVYFIERGF        60
     AAVQVRTQAD GTHGVGLVGR FGMTGLSLLL GTRRAPFRIS VQVAGEAFRL DAAEAAALFA       120
     ENTALRRLGL AYIQAVMVQG AQLSLCNARH SMKHRVRRWL LLAQDWLGEP EIAVSHQLIA       180
     GLLGVRRASV SEQIERLEQA GIVRQQRASI TVLCREALEQ DSCECHALIS AEYRRLFTRR       240
//

If you have problems or comments...

PBIL Back to PBIL home page