(data stored in ACNUC7421 zone)

EMBL: CP001349.PE404

CP001349.PE404       Location/Qualifiers
FT   CDS             465273..467066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0414"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: met:M446_2089 thiamine pyrophosphate binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55456"
FT                   /db_xref="GOA:B8IC68"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC68"
FT                   /inference="protein motif:PFAM:PF02776"
FT                   /protein_id="ACL55456.1"
FT                   /translation="MAETVGDFVCQRLSDWGVRTIFGYPGDGINGLLGAMQRHDPPFAF
FT                   IQVRHEEMAAFMACAYAKFTGELGVCLATSGPGATHLITGLYDARLDHMPVLAIVGQQA
FT                   RNALGGHYQQELDLTSAFKDVAGAFVQQASAPAQVRHLVDRAVRIARAGRQVTALVLPN
FT                   DLQDAPYEDPPRKHGTLQSGVGYSDPRVLPKDADLKQAAAVLNAGERVAILVGAGALHA
FT                   ADEVIAVAERLQAGAAKALLGKAALPDDLPWVTGSIGLLGTKPSWDLMTECDTLLMIGS
FT                   GFPYAEFLPKPGQARGVQIDLKAEMLSLRYPMEVPLVGDSEETLRALLPLLNQKPTGGE
FT                   WRNRIEEGVTAWWKEAGDRAMAKANPVNPQRVTWELSPRLPDRAIITSDSGSCANWFAR
FT                   DLKIRRDMMCSLSGGLASMGAAVPYAIAAKVAHPDRPVIALVGDGAMQMNNMAELITVA
FT                   KYRHLWPNQTWICCVFNNEDLNQVTWEQRVQAGNPKYEATQVIPNVPYHRFAELIGLKG
FT                   LYVDDPERVGTAWDEALASPVPVVLEVKTDPEVPPLPPHITLEQARNFMAMLWQGEPKE
FT                   GHLLADTARQVLSRVLPGEGG"
     MAETVGDFVC QRLSDWGVRT IFGYPGDGIN GLLGAMQRHD PPFAFIQVRH EEMAAFMACA        60
     YAKFTGELGV CLATSGPGAT HLITGLYDAR LDHMPVLAIV GQQARNALGG HYQQELDLTS       120
     AFKDVAGAFV QQASAPAQVR HLVDRAVRIA RAGRQVTALV LPNDLQDAPY EDPPRKHGTL       180
     QSGVGYSDPR VLPKDADLKQ AAAVLNAGER VAILVGAGAL HAADEVIAVA ERLQAGAAKA       240
     LLGKAALPDD LPWVTGSIGL LGTKPSWDLM TECDTLLMIG SGFPYAEFLP KPGQARGVQI       300
     DLKAEMLSLR YPMEVPLVGD SEETLRALLP LLNQKPTGGE WRNRIEEGVT AWWKEAGDRA       360
     MAKANPVNPQ RVTWELSPRL PDRAIITSDS GSCANWFARD LKIRRDMMCS LSGGLASMGA       420
     AVPYAIAAKV AHPDRPVIAL VGDGAMQMNN MAELITVAKY RHLWPNQTWI CCVFNNEDLN       480
     QVTWEQRVQA GNPKYEATQV IPNVPYHRFA ELIGLKGLYV DDPERVGTAW DEALASPVPV       540
     VLEVKTDPEV PPLPPHITLE QARNFMAMLW QGEPKEGHLL ADTARQVLSR VLPGEGG          597
//

If you have problems or comments...

PBIL Back to PBIL home page