(data stored in ACNUC7421 zone)

EMBL: CP001349.PE405

CP001349.PE405       Location/Qualifiers
FT   CDS             467070..468164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0415"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: met:M446_2088 mandelate racemase/muconate
FT                   lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55457"
FT                   /db_xref="GOA:B8IC69"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC69"
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /protein_id="ACL55457.1"
FT                   /translation="MRPEAPISAVSARAYAVPTDAPEADGTFAWRRTTLVVTAITAGSC
FT                   TGLGYTYSHAGDAGLIAGTLGPLLDGGDPFDVPALTARLWREVRNIGRAGMAATAISAL
FT                   DAALWDLKARLLGLPLVRLLGAARPAVPIYGSGGFTSYSDAQLTEQLAGFVGRDGCRAV
FT                   KIKIGSFPERDPARMRLARSAIGAAELFIDANGAFAPRAALAMAETARDFGVRWFEEPV
FT                   SSDDIAGLRFVRERVPAGIEVAAGEYAYDLDDIRRLLAAGAVDVQQADVTRCGGITGFL
FT                   AAGTLCAAHHTDLSGHCAPALHLHAACAVPRLRHLEWFHDHVRIEAMLFEGAPVPRDGQ
FT                   IAPDLTRPGHGLTFRQQDAERYAV"
     MRPEAPISAV SARAYAVPTD APEADGTFAW RRTTLVVTAI TAGSCTGLGY TYSHAGDAGL        60
     IAGTLGPLLD GGDPFDVPAL TARLWREVRN IGRAGMAATA ISALDAALWD LKARLLGLPL       120
     VRLLGAARPA VPIYGSGGFT SYSDAQLTEQ LAGFVGRDGC RAVKIKIGSF PERDPARMRL       180
     ARSAIGAAEL FIDANGAFAP RAALAMAETA RDFGVRWFEE PVSSDDIAGL RFVRERVPAG       240
     IEVAAGEYAY DLDDIRRLLA AGAVDVQQAD VTRCGGITGF LAAGTLCAAH HTDLSGHCAP       300
     ALHLHAACAV PRLRHLEWFH DHVRIEAMLF EGAPVPRDGQ IAPDLTRPGH GLTFRQQDAE       360
     RYAV                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page