(data stored in ACNUC7421 zone)

EMBL: CP001349.PE406

CP001349.PE406       Location/Qualifiers
FT   CDS             468154..469215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55458"
FT                   /db_xref="GOA:B8IC70"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC70"
FT                   /inference="similar to AA sequence:KEGG:M446_2087"
FT                   /protein_id="ACL55458.1"
FT                   /translation="MRFEIDAEDPPSPRAGSGAPVRPAGPVRPALGRPALGRPAVSARI
FT                   RLTAHPVAALACAAACIGAATWIAAGRSRKPAPGRPDGAAAEAARRLNRASTLLATSVL
FT                   LDSGLEHERGQYFNRAMVTPVLVSSAVLACSLHGAGPAGREASRLRHAVQAAAAVTGLA
FT                   GLGFHAYNVGKREGGYSWNNLFYAAPIGAPFALTLAGALGVAAEHVRAADPDHPRLLGL
FT                   PAGPLLAAGTAFGLAGTVGEAGLLHFRGAFHNPAMLLPVTVPPLAGALMAWAAWSPRGR
FT                   RPVTRAWLRATAALGLGGVALHAYGVSRAMGGWRNWRQNLLDGPPLPAPPAFTGIALAG
FT                   LAALDLMERHDHG"
     MRFEIDAEDP PSPRAGSGAP VRPAGPVRPA LGRPALGRPA VSARIRLTAH PVAALACAAA        60
     CIGAATWIAA GRSRKPAPGR PDGAAAEAAR RLNRASTLLA TSVLLDSGLE HERGQYFNRA       120
     MVTPVLVSSA VLACSLHGAG PAGREASRLR HAVQAAAAVT GLAGLGFHAY NVGKREGGYS       180
     WNNLFYAAPI GAPFALTLAG ALGVAAEHVR AADPDHPRLL GLPAGPLLAA GTAFGLAGTV       240
     GEAGLLHFRG AFHNPAMLLP VTVPPLAGAL MAWAAWSPRG RRPVTRAWLR ATAALGLGGV       300
     ALHAYGVSRA MGGWRNWRQN LLDGPPLPAP PAFTGIALAG LAALDLMERH DHG              353
//

If you have problems or comments...

PBIL Back to PBIL home page