(data stored in ACNUC7421 zone)

EMBL: CP001349.PE407

CP001349.PE407       Location/Qualifiers
FT   CDS             469208..469882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55459"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC71"
FT                   /inference="similar to AA sequence:KEGG:M446_2086"
FT                   /protein_id="ACL55459.1"
FT                   /translation="MAEPKAVRRDLYPGYDVLAKRDGPSWNAQTRAVIDERLAIGPGTH
FT                   RFFTDAEFETLRAICARIVPQPPGEPDRIPVAALIDDRLHRGERDGYRDARMPPEDEAW
FT                   RRGLRALDAEALAAHGLRFHLLDEAAQDALLAAASRGELAQAAWGGMPCDLFFGQRLVD
FT                   DCVRAYYAHPAAWSEIGWGGPASPRGYVRMDFDRRDPWEAAEAKPGREEEARQANLRVG
FT                   RM"
     MAEPKAVRRD LYPGYDVLAK RDGPSWNAQT RAVIDERLAI GPGTHRFFTD AEFETLRAIC        60
     ARIVPQPPGE PDRIPVAALI DDRLHRGERD GYRDARMPPE DEAWRRGLRA LDAEALAAHG       120
     LRFHLLDEAA QDALLAAASR GELAQAAWGG MPCDLFFGQR LVDDCVRAYY AHPAAWSEIG       180
     WGGPASPRGY VRMDFDRRDP WEAAEAKPGR EEEARQANLR VGRM                        224
//

If you have problems or comments...

PBIL Back to PBIL home page