(data stored in ACNUC7421 zone)

EMBL: CP001349.PE408

CP001349.PE408       Location/Qualifiers
FT   CDS             469890..471611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0418"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: met:M446_2085
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55460"
FT                   /db_xref="GOA:B8IC72"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC72"
FT                   /inference="protein motif:PFAM:PF00732"
FT                   /protein_id="ACL55460.1"
FT                   /translation="MRLPGTGGAADNPRFAVPDDDPMRVPRARDGRAPNVMRIGEWVPM
FT                   RQHRDDEEVDFAIVGTGAGGGTLACRLAEEGFSVVAFDAGPYWRPLEDFASDESHQSKL
FT                   YWTDERLVDGENPLQLGSNNSGRSVGGSTVHFAMVSLRFRPEWFRSRTLLGYGADWPID
FT                   WREMWDYYGQVEQALKISGPVTYPWGPKRPRYPYRAHELNAAARVLARGAEALGIGWAP
FT                   TPLATVSAPRGDSPPCVYRGFCTLGCSTNAKQSVLVTWLPRALRAGAEIRDLAMVGWIE
FT                   TSAGRATGLHYHREGRWRFQKARNVVVAGYAIETPRLLLMSANAEFPDGLANSSGLVGR
FT                   YLTVQGNQAVWGVMQQEIRSYKGPPSLALTEHWNYEDRGKDFFGGYCYMSQGPLPVLWS
FT                   RTLSGSRGLWGEALVAEMQRYNHVAGLKVVSEYMPQERNRVTLADETDQYGLPIPRITY
FT                   SWCDNDKAVNRHSLAFMRRALEAAGGGEIWEQENDTCHLNGTARMGSDPRTSVVDADCR
FT                   SWDIPNLWICDGSVFPTVGGVNPSLTIQAIALRTADRIAALAARGDLSGAARASSA"
     MRLPGTGGAA DNPRFAVPDD DPMRVPRARD GRAPNVMRIG EWVPMRQHRD DEEVDFAIVG        60
     TGAGGGTLAC RLAEEGFSVV AFDAGPYWRP LEDFASDESH QSKLYWTDER LVDGENPLQL       120
     GSNNSGRSVG GSTVHFAMVS LRFRPEWFRS RTLLGYGADW PIDWREMWDY YGQVEQALKI       180
     SGPVTYPWGP KRPRYPYRAH ELNAAARVLA RGAEALGIGW APTPLATVSA PRGDSPPCVY       240
     RGFCTLGCST NAKQSVLVTW LPRALRAGAE IRDLAMVGWI ETSAGRATGL HYHREGRWRF       300
     QKARNVVVAG YAIETPRLLL MSANAEFPDG LANSSGLVGR YLTVQGNQAV WGVMQQEIRS       360
     YKGPPSLALT EHWNYEDRGK DFFGGYCYMS QGPLPVLWSR TLSGSRGLWG EALVAEMQRY       420
     NHVAGLKVVS EYMPQERNRV TLADETDQYG LPIPRITYSW CDNDKAVNRH SLAFMRRALE       480
     AAGGGEIWEQ ENDTCHLNGT ARMGSDPRTS VVDADCRSWD IPNLWICDGS VFPTVGGVNP       540
     SLTIQAIALR TADRIAALAA RGDLSGAARA SSA                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page