(data stored in ACNUC7421 zone)

EMBL: CP001349.PE409

CP001349.PE409       Location/Qualifiers
FT   CDS             471627..472517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0419"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: met:M446_2084 SMP-30/gluconolaconase/LRE
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55461"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC73"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ACL55461.1"
FT                   /translation="MTPARIDILVQARAVIGEAPFWSGREPALYWIDVKAPALFRTDPE
FT                   TGDTRRWTLPAEIGGYALLADRSGAIVALRSGIFALAFASGDLDRLAGPPFDPRTHRFN
FT                   EGDCDPAGRLWLGTMFDPLPGVKAEPRADHLYAFTLAGGLVRHAETAFVANGFAWSPDG
FT                   GRLYLADSRAGRIDAVAFDAARGRLGLRQPFAAVPSGLGVPDGGAVDAEGFYWSAIHGG
FT                   SCLHRYAPDGRLDRRLPLPVRYPTMMAFGGGDLATLFVTSATHGEPGSPQDGAVLRLRP
FT                   GVRGEPRPLFGETRP"
     MTPARIDILV QARAVIGEAP FWSGREPALY WIDVKAPALF RTDPETGDTR RWTLPAEIGG        60
     YALLADRSGA IVALRSGIFA LAFASGDLDR LAGPPFDPRT HRFNEGDCDP AGRLWLGTMF       120
     DPLPGVKAEP RADHLYAFTL AGGLVRHAET AFVANGFAWS PDGGRLYLAD SRAGRIDAVA       180
     FDAARGRLGL RQPFAAVPSG LGVPDGGAVD AEGFYWSAIH GGSCLHRYAP DGRLDRRLPL       240
     PVRYPTMMAF GGGDLATLFV TSATHGEPGS PQDGAVLRLR PGVRGEPRPL FGETRP           296
//

If you have problems or comments...

PBIL Back to PBIL home page