(data stored in ACNUC7421 zone)

EMBL: CP001349.PE41

CP001349.PE41        Location/Qualifiers
FT   CDS             44871..46067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0042"
FT                   /product="lytic murein transglycosylase"
FT                   /note="TIGRFAM: lytic murein transglycosylase; PFAM:
FT                   Peptidoglycan-binding domain 1 protein; KEGG: met:M446_0041
FT                   lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55093"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU48"
FT                   /inference="protein motif:TFAM:TIGR02283"
FT                   /protein_id="ACL55093.1"
FT                   /translation="MTRRARTTVATLLCLGGLALPGAAQADFRSCLAGLGREAAAHGIS
FT                   PSTFQSATAGIVYDDKVIELSQAQPEFKTPIWDYIAALVDEERVEDGRAAMRQYASALA
FT                   QAEARFNVDRYTIAAVWGVESNFGKNLGKMPLVQSLATLACSSNRRAGFFKGELMATLK
FT                   IIDRGDIEASRLTGSWAGAFGQTQFMPSTYQRLAVDLDGDGRRDVVDSVADAVGSTANF
FT                   LRVAKWQNGLPWGYEVRLPRGFNLAAAGRKSKRPVSHWASLGVTRIDGRQLTGEGQAGI
FT                   IAPAGIDGPAFLVTRNFDAIYSYNAAESYGLAIAILSDRLRGRSGIQTAWPTDDPPLSR
FT                   AERRALQSALASRGYDVGEPDGRVGAKTRDAIKDIERQLGWPQTGRPGAKVLEALRRG"
     MTRRARTTVA TLLCLGGLAL PGAAQADFRS CLAGLGREAA AHGISPSTFQ SATAGIVYDD        60
     KVIELSQAQP EFKTPIWDYI AALVDEERVE DGRAAMRQYA SALAQAEARF NVDRYTIAAV       120
     WGVESNFGKN LGKMPLVQSL ATLACSSNRR AGFFKGELMA TLKIIDRGDI EASRLTGSWA       180
     GAFGQTQFMP STYQRLAVDL DGDGRRDVVD SVADAVGSTA NFLRVAKWQN GLPWGYEVRL       240
     PRGFNLAAAG RKSKRPVSHW ASLGVTRIDG RQLTGEGQAG IIAPAGIDGP AFLVTRNFDA       300
     IYSYNAAESY GLAIAILSDR LRGRSGIQTA WPTDDPPLSR AERRALQSAL ASRGYDVGEP       360
     DGRVGAKTRD AIKDIERQLG WPQTGRPGAK VLEALRRG                               398
//

If you have problems or comments...

PBIL Back to PBIL home page