(data stored in ACNUC7421 zone)

EMBL: CP001349.PE410

CP001349.PE410       Location/Qualifiers
FT   CDS             472514..473509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0420"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: met:M446_2083 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55462"
FT                   /db_xref="GOA:B8IC74"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC74"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL55462.1"
FT                   /translation="MTGGRPRAIVTGGTAGVGRAVAAEFARQGYDVAVLARGRRGLDAT
FT                   VAELRRLGARALGIEADVADAAAVFRAADEAASAFGGIDVWVNNAMVTMYAPVQRTHPD
FT                   EFRQVTAVTYLGQVHGTLAALRHMVPADRGTILCIGSALAYRSIPLQASYCAAKAAVRG
FT                   FVDSLRSELLHDGSRVRLTMVQLPAVNTPQFDWARSVLPRRLQPVPPIFQPEAIARHVV
FT                   RAARRAPREIWIGMPAWKAILGTMAAPGLIDRFLARQGYRGEMTDAPAVPGRPDNLFAP
FT                   VDTAPGAHGRFDARAHGRVVAARPSTLKAGLALGLLAGGALLAARRQWPR"
     MTGGRPRAIV TGGTAGVGRA VAAEFARQGY DVAVLARGRR GLDATVAELR RLGARALGIE        60
     ADVADAAAVF RAADEAASAF GGIDVWVNNA MVTMYAPVQR THPDEFRQVT AVTYLGQVHG       120
     TLAALRHMVP ADRGTILCIG SALAYRSIPL QASYCAAKAA VRGFVDSLRS ELLHDGSRVR       180
     LTMVQLPAVN TPQFDWARSV LPRRLQPVPP IFQPEAIARH VVRAARRAPR EIWIGMPAWK       240
     AILGTMAAPG LIDRFLARQG YRGEMTDAPA VPGRPDNLFA PVDTAPGAHG RFDARAHGRV       300
     VAARPSTLKA GLALGLLAGG ALLAARRQWP R                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page