(data stored in ACNUC7421 zone)

EMBL: CP001349.PE411

CP001349.PE411       Location/Qualifiers
FT   CDS             complement(473856..475628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0421"
FT                   /product="PQQ-dependent dehydrogenase, methanol/ethanol
FT                   family"
FT                   /note="TIGRFAM: PQQ-dependent dehydrogenase,
FT                   methanol/ethanol family; PFAM: Pyrrolo-quinoline quinone;
FT                   KEGG: met:M446_2082 methanol/ethanol family PQQ-dependent
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55463"
FT                   /db_xref="GOA:B8IC75"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC75"
FT                   /inference="protein motif:TFAM:TIGR03075"
FT                   /protein_id="ACL55463.1"
FT                   /translation="MIRLLVLFALGLSALPARAGDSPAKPVLQTVDYANTRYAALDQID
FT                   AGNVGRLRVAWTFSTGVLRGHEGAPLVIGSIMVVHTPFPNVVSALDLDHEGRVLWRYSP
FT                   RQEANVIPVMCCDTVWRGPAYAGGRLFLQLADTTVVALDLATGRELWSVKNGDPARGET
FT                   NTATVLPVKDKLIVGISGGEYGARCHVTAYDQATGRRLWRAYAMGPDADMLIDPERTTE
FT                   LGRPVGRDSSLRSWEGDQWRLGGGCSWGWFSYDPDLDLVYYGTGNPSTWNPAQRPGGNR
FT                   WSMAILARDPDTGMARWVYQMTPHDQWDYDGVNEMILTDQDIDGRPRKLLTHFDRNGFG
FT                   YTLDRASGELLVAEKFDPSVNWARRIVMDPGSPAHGRPEIDPRYAPETAGEDETTTGIC
FT                   PGALGAKNQQPAAYSPQTRLFYVPTNHMCMDYEPFRVTYSPGQPYVGATLTLHPPAGAE
FT                   NTGAFIAWDGTRGRIAWSIPEPFSVWSGALATAGGIVFYGTLEGYLKAVDARTGRELYR
FT                   FKTPSGIVGNVTTYMHRGRQYVAVLSGIGGWAGIGLAAGLTDPAEGSGAVGGYAALSQY
FT                   TAPGGVLTVFALPE"
     MIRLLVLFAL GLSALPARAG DSPAKPVLQT VDYANTRYAA LDQIDAGNVG RLRVAWTFST        60
     GVLRGHEGAP LVIGSIMVVH TPFPNVVSAL DLDHEGRVLW RYSPRQEANV IPVMCCDTVW       120
     RGPAYAGGRL FLQLADTTVV ALDLATGREL WSVKNGDPAR GETNTATVLP VKDKLIVGIS       180
     GGEYGARCHV TAYDQATGRR LWRAYAMGPD ADMLIDPERT TELGRPVGRD SSLRSWEGDQ       240
     WRLGGGCSWG WFSYDPDLDL VYYGTGNPST WNPAQRPGGN RWSMAILARD PDTGMARWVY       300
     QMTPHDQWDY DGVNEMILTD QDIDGRPRKL LTHFDRNGFG YTLDRASGEL LVAEKFDPSV       360
     NWARRIVMDP GSPAHGRPEI DPRYAPETAG EDETTTGICP GALGAKNQQP AAYSPQTRLF       420
     YVPTNHMCMD YEPFRVTYSP GQPYVGATLT LHPPAGAENT GAFIAWDGTR GRIAWSIPEP       480
     FSVWSGALAT AGGIVFYGTL EGYLKAVDAR TGRELYRFKT PSGIVGNVTT YMHRGRQYVA       540
     VLSGIGGWAG IGLAAGLTDP AEGSGAVGGY AALSQYTAPG GVLTVFALPE                  590
//

If you have problems or comments...

PBIL Back to PBIL home page