(data stored in ACNUC7421 zone)

EMBL: CP001349.PE412

CP001349.PE412       Location/Qualifiers
FT   CDS             475849..476589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0422"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: met:M446_6132 Crp/FNR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55464"
FT                   /db_xref="GOA:B8IC76"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC76"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACL55464.1"
FT                   /translation="MLVDTGSCDAFGTACSHRRPRNSCVDCKVRPISVCSVLALDELAV
FT                   LETLGQHLSLDKRQVLYGQEEPAEAVFNVIDGSLRLTRLLSDGRRQVMGFALPGDFLGL
FT                   AREDRFSVSAEALTPVTVCRFERRAFGALVDDKPHLLRSLHERAGHELTLAQDQMLLLG
FT                   RRTAEERVASFLVGLRERYARMGRASVTLELPMGRQDMADYLGLTIETVSRMLTRLDRE
FT                   RTVLIVPGGVRLLDPARLEALAAS"
     MLVDTGSCDA FGTACSHRRP RNSCVDCKVR PISVCSVLAL DELAVLETLG QHLSLDKRQV        60
     LYGQEEPAEA VFNVIDGSLR LTRLLSDGRR QVMGFALPGD FLGLAREDRF SVSAEALTPV       120
     TVCRFERRAF GALVDDKPHL LRSLHERAGH ELTLAQDQML LLGRRTAEER VASFLVGLRE       180
     RYARMGRASV TLELPMGRQD MADYLGLTIE TVSRMLTRLD RERTVLIVPG GVRLLDPARL       240
     EALAAS                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page