(data stored in ACNUC7421 zone)

EMBL: CP001349.PE413

CP001349.PE413       Location/Qualifiers
FT   CDS             complement(476605..477420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0423"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: met:M446_6131 UspA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55465"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC77"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACL55465.1"
FT                   /translation="MSIASIMTSVDLGPGAAERVRLAAGLAARFEATLTGIAARPFPAA
FT                   GPIDRGVEIQAIADEGRARLADELRQVRSVFARGAGEGVRTAWQQGDGDPEGFLIRQSR
FT                   GADLVVVSRRGPRDPDPGPFGVAPDRILMEAARPVLVVPPGLEHLRGARIVVAWKDTPE
FT                   ALRAVSAALPFIVQADQVFVATAGEGARFEGGQDVAELLARHGAHVTTHLLSAPPRETT
FT                   DEILRFAARQDADLLVMGAYGHARLRQWLFGGATREILRMVPVCCLMSH"
     MSIASIMTSV DLGPGAAERV RLAAGLAARF EATLTGIAAR PFPAAGPIDR GVEIQAIADE        60
     GRARLADELR QVRSVFARGA GEGVRTAWQQ GDGDPEGFLI RQSRGADLVV VSRRGPRDPD       120
     PGPFGVAPDR ILMEAARPVL VVPPGLEHLR GARIVVAWKD TPEALRAVSA ALPFIVQADQ       180
     VFVATAGEGA RFEGGQDVAE LLARHGAHVT THLLSAPPRE TTDEILRFAA RQDADLLVMG       240
     AYGHARLRQW LFGGATREIL RMVPVCCLMS H                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page