(data stored in ACNUC7421 zone)

EMBL: CP001349.PE414

CP001349.PE414       Location/Qualifiers
FT   CDS             complement(477560..477823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC78"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55466.1"
FT                   /translation="MSAVALPEPGQPPIDAAWLAALQRMCMDLPIAMAGEMGDLMVAAI
FT                   APPTAEGDETVLGAAPQPDASPDPHREDLPSHDLPDIESCFA"
     MSAVALPEPG QPPIDAAWLA ALQRMCMDLP IAMAGEMGDL MVAAIAPPTA EGDETVLGAA        60
     PQPDASPDPH REDLPSHDLP DIESCFA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page