(data stored in ACNUC7421 zone)

EMBL: CP001349.PE415

CP001349.PE415       Location/Qualifiers
FT   CDS             complement(477820..478215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55467"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC79"
FT                   /inference="similar to AA sequence:KEGG:M446_3595"
FT                   /protein_id="ACL55467.1"
FT                   /translation="MLSTITLTLARCAEYPEGSAGRGYQITAPLDPDGHLDQVRWREAR
FT                   DHCRVRRFWTGEPDRHGRLVHRAGGPGGATWLIDYDDRTAEDDETGYRLGVHRFVEGEY
FT                   VSVRGADEDGLHTFRVARVARAPGGPS"
     MLSTITLTLA RCAEYPEGSA GRGYQITAPL DPDGHLDQVR WREARDHCRV RRFWTGEPDR        60
     HGRLVHRAGG PGGATWLIDY DDRTAEDDET GYRLGVHRFV EGEYVSVRGA DEDGLHTFRV       120
     ARVARAPGGP S                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page