(data stored in ACNUC7421 zone)

EMBL: CP001349.PE418

CP001349.PE418       Location/Qualifiers
FT   CDS             complement(478936..481767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0428"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: met:M446_2081 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; GAF domain protein; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55470"
FT                   /db_xref="GOA:B8IC82"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC82"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACL55470.1"
FT                   /translation="MTHIATAPGATASRPGFAVGEAGRLAALRSYAILDTPREAEFDDI
FT                   AQMAAQACGTPMAHINFIDAHRQWIKAAVGHDMREMPLEFGFCTELLGSPDILLLSGLD
FT                   ADPGRSGNVLVAGAPHLRFYAGVPLVTPDGYAIGTLCVLDRVPRTLTEPQRFILKALAR
FT                   TVMAQLEMRRTDAALRASEERYRSLFNSIDAGFCVVEMEFDAAGRAADCRFLEVNPAFE
FT                   AQTGLVGAVGRRLRDLDPDHDQPWFDISGQVALTGRPVRFENAAPALKRWYDVHAYRVD
FT                   DPARHRVAILFNDITRRRENEMALLEREAESRLVADAMPALIAAIDRSFTYRFVNAAYE
FT                   TWFGHPREAVLGRTMSELIGPAEFAFRRPYVERALAGEEVRLERNWPWPDGRPRVADIR
FT                   YLPRRTPEGSIDGVYVFVHDVTDRKRVEDFLEAKAQSLEAQIAAQARDRDRIWTLSPVL
FT                   KVVATARGEVLSVNPSWVRTLGWSEAESLGRSLLDFVAPEDRDVMTGELERRLSGVPGG
FT                   DIEVAFLTQTGEPRRILWTIVPEEGTLYGFGRDVSEQRRAEEALRQSQKLEAVGQLTGG
FT                   VAHDFNNLLTIIRSSVDFLRRPDLPEERRRRYLDAVSDTVDRAAKLTGQLLAFARRQAL
FT                   KLEVIDVGVRLQAVAEMLDAVTGARIRVVTQVPDRPCFVRTDLSQFETALVNIAVNARD
FT                   AMNGEGTLTLRLACGCALPAIRGHAGAPGPFAAVSLTDTGAGIPPDLIGRIFEPFFTTK
FT                   EVGRGTGLGLSQVFGFAKQSGGDIAVESTPGQGTTFTLYLPQVEMADGLAGGDPDARSL
FT                   SPAGNGRRVLVVEDNVEVGRFACQILQDLGFTPEWASNAEEALERLEPDGAGFDAVFSD
FT                   VVMPGMGGIALARELRRRLPCLPVVLASGYSHVLAQEGAHGFELLHKPYSGEELGRLLH
FT                   RVTARAPAAPHGG"
     MTHIATAPGA TASRPGFAVG EAGRLAALRS YAILDTPREA EFDDIAQMAA QACGTPMAHI        60
     NFIDAHRQWI KAAVGHDMRE MPLEFGFCTE LLGSPDILLL SGLDADPGRS GNVLVAGAPH       120
     LRFYAGVPLV TPDGYAIGTL CVLDRVPRTL TEPQRFILKA LARTVMAQLE MRRTDAALRA       180
     SEERYRSLFN SIDAGFCVVE MEFDAAGRAA DCRFLEVNPA FEAQTGLVGA VGRRLRDLDP       240
     DHDQPWFDIS GQVALTGRPV RFENAAPALK RWYDVHAYRV DDPARHRVAI LFNDITRRRE       300
     NEMALLEREA ESRLVADAMP ALIAAIDRSF TYRFVNAAYE TWFGHPREAV LGRTMSELIG       360
     PAEFAFRRPY VERALAGEEV RLERNWPWPD GRPRVADIRY LPRRTPEGSI DGVYVFVHDV       420
     TDRKRVEDFL EAKAQSLEAQ IAAQARDRDR IWTLSPVLKV VATARGEVLS VNPSWVRTLG       480
     WSEAESLGRS LLDFVAPEDR DVMTGELERR LSGVPGGDIE VAFLTQTGEP RRILWTIVPE       540
     EGTLYGFGRD VSEQRRAEEA LRQSQKLEAV GQLTGGVAHD FNNLLTIIRS SVDFLRRPDL       600
     PEERRRRYLD AVSDTVDRAA KLTGQLLAFA RRQALKLEVI DVGVRLQAVA EMLDAVTGAR       660
     IRVVTQVPDR PCFVRTDLSQ FETALVNIAV NARDAMNGEG TLTLRLACGC ALPAIRGHAG       720
     APGPFAAVSL TDTGAGIPPD LIGRIFEPFF TTKEVGRGTG LGLSQVFGFA KQSGGDIAVE       780
     STPGQGTTFT LYLPQVEMAD GLAGGDPDAR SLSPAGNGRR VLVVEDNVEV GRFACQILQD       840
     LGFTPEWASN AEEALERLEP DGAGFDAVFS DVVMPGMGGI ALARELRRRL PCLPVVLASG       900
     YSHVLAQEGA HGFELLHKPY SGEELGRLLH RVTARAPAAP HGG                         943
//

If you have problems or comments...

PBIL Back to PBIL home page