(data stored in ACNUC7421 zone)

EMBL: CP001349.PE419

CP001349.PE419       Location/Qualifiers
FT   CDS             482216..484447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0429"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: mpo:Mpop_0141 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55471"
FT                   /db_xref="GOA:B8IC83"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC83"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACL55471.1"
FT                   /translation="MLGLFSCLTNEHIPHLLALNVLLAAATAFAMLSFLAAGRGLNGAW
FT                   TPLRQGFAGPAVALFAAGFAALHLLGPVGTVVPGRIVWDTGLAAGAVLSGTMLAAGAIR
FT                   LAIRRPGVPACIAASFLLALGLCGLQVLALAAASVVPDAPPLPTPLLSRDAIAGAVAAA
FT                   SALLLAVATHGIVADARAAALRNAVARLRALTEASFEGIVVVRDGRVLDVNPSFCALIG
FT                   RPAEALRGEALAALTDPDSLPLLAGAESPASHETRLRCADGTTVPVEVRARPWSTGDAA
FT                   YAIAVRSLRERHEADRRIRMLAYRDQATSLPNRAAFDEALRAQITACVRNNTTFSLHRI
FT                   DLDRFKDINITFGHALADQVLAGLARRLAQVVEAGTLDRVFRLGDDEFAVLQIDSERAR
FT                   PPETVARQIVEHLAAPVVVADRQVQIRASVGVAVWPEDGSGGEMLLKRSGLALDRAKRD
FT                   GGGRHCRYDESLVAAIEARRRLQEDLAAGLRDGAFTIVYLPIVSFASRRIVGHEALLRW
FT                   RHPRLGEIPPSRFIPLAEECGAIVDLGQLVLAEACRQAATWTEDHLVAVNVSGPQLQTD
FT                   DFIDLVDAVLRQTGLPPERLQIEVTEAILIDDRHRVAQRLRTLRARGVRVALDDFGKGL
FT                   SSLQLPRDIPFDAVKLDVSIIRGLVQGREQRAVVEALIGLLHHLGRVTVAEGVETREQW
FT                   EALRAAGCDLAQGVLFGTPRAQPIAGDVLIEPLPPAVTRLSDYLRRRDG"
     MLGLFSCLTN EHIPHLLALN VLLAAATAFA MLSFLAAGRG LNGAWTPLRQ GFAGPAVALF        60
     AAGFAALHLL GPVGTVVPGR IVWDTGLAAG AVLSGTMLAA GAIRLAIRRP GVPACIAASF       120
     LLALGLCGLQ VLALAAASVV PDAPPLPTPL LSRDAIAGAV AAASALLLAV ATHGIVADAR       180
     AAALRNAVAR LRALTEASFE GIVVVRDGRV LDVNPSFCAL IGRPAEALRG EALAALTDPD       240
     SLPLLAGAES PASHETRLRC ADGTTVPVEV RARPWSTGDA AYAIAVRSLR ERHEADRRIR       300
     MLAYRDQATS LPNRAAFDEA LRAQITACVR NNTTFSLHRI DLDRFKDINI TFGHALADQV       360
     LAGLARRLAQ VVEAGTLDRV FRLGDDEFAV LQIDSERARP PETVARQIVE HLAAPVVVAD       420
     RQVQIRASVG VAVWPEDGSG GEMLLKRSGL ALDRAKRDGG GRHCRYDESL VAAIEARRRL       480
     QEDLAAGLRD GAFTIVYLPI VSFASRRIVG HEALLRWRHP RLGEIPPSRF IPLAEECGAI       540
     VDLGQLVLAE ACRQAATWTE DHLVAVNVSG PQLQTDDFID LVDAVLRQTG LPPERLQIEV       600
     TEAILIDDRH RVAQRLRTLR ARGVRVALDD FGKGLSSLQL PRDIPFDAVK LDVSIIRGLV       660
     QGREQRAVVE ALIGLLHHLG RVTVAEGVET REQWEALRAA GCDLAQGVLF GTPRAQPIAG       720
     DVLIEPLPPA VTRLSDYLRR RDG                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page