(data stored in ACNUC7421 zone)

EMBL: CP001349.PE42

CP001349.PE42        Location/Qualifiers
FT   CDS             complement(46344..47576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0043"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   met:M446_0043 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55094"
FT                   /db_xref="GOA:B8IU49"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU49"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL55094.1"
FT                   /translation="MQTIRESRPRDGRENEAGREAARLRRPLWIALGLMLIAFNLRPAL
FT                   SSVGPLLARIREDTGMSGALAGALITLPVLCLGVFGRLGPPVTRRLGPDAGVLAFLIVI
FT                   AAGLVLRGFGGLPALFAGSVLAAGGIGVVGVILPGIVKRDFPERPGLMMGLYTAVLCLG
FT                   AAAGAGLTVPAGRLLESGWQGPMMIWALPVLLAALAWLPFVRAAPASPGLGPRRFAALW
FT                   RDRLAWQVTGFMGLQSSLAYIVFGWLPAALTDRGFDPLAAGLVASLSAMAQTVLALLVP
FT                   TLAGRSRDQRPWVLLVVGLAVGGFCGLLVGPIGLVWPFALMLGLGLGGCFGLALTLIVL
FT                   RSPDAQTAGDLSAMAQGVGYTLAALGPLLIGLAHDASDGWGIPAALYGGLGLAAATLGL
FT                   LAARNRHVLAR"
     MQTIRESRPR DGRENEAGRE AARLRRPLWI ALGLMLIAFN LRPALSSVGP LLARIREDTG        60
     MSGALAGALI TLPVLCLGVF GRLGPPVTRR LGPDAGVLAF LIVIAAGLVL RGFGGLPALF       120
     AGSVLAAGGI GVVGVILPGI VKRDFPERPG LMMGLYTAVL CLGAAAGAGL TVPAGRLLES       180
     GWQGPMMIWA LPVLLAALAW LPFVRAAPAS PGLGPRRFAA LWRDRLAWQV TGFMGLQSSL       240
     AYIVFGWLPA ALTDRGFDPL AAGLVASLSA MAQTVLALLV PTLAGRSRDQ RPWVLLVVGL       300
     AVGGFCGLLV GPIGLVWPFA LMLGLGLGGC FGLALTLIVL RSPDAQTAGD LSAMAQGVGY       360
     TLAALGPLLI GLAHDASDGW GIPAALYGGL GLAAATLGLL AARNRHVLAR                  410
//

If you have problems or comments...

PBIL Back to PBIL home page