(data stored in ACNUC7421 zone)

EMBL: CP001349.PE420

CP001349.PE420       Location/Qualifiers
FT   CDS             485121..486401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55472"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC84"
FT                   /inference="similar to AA sequence:KEGG:M446_2080"
FT                   /protein_id="ACL55472.1"
FT                   /translation="MPIALSFPLHGGWGLADLGAFGHAERDGRPTALGRRARETSTVAG
FT                   LQMVLDPPSASAAAATRPARRAGPLAASLIALLSLTVSGDWHPAEAPPAPTGSRGQAEA
FT                   PPAPVEEAPPAVTRADAAPAPPVQGLSVETPVPWQSALLDSVLEAALAPPSDPVEAPAS
FT                   ETPDEARTAAPDDLSQDPARLAQPVPLPVPRPPELRRPRTAEPARGASRSAAQRAGVAS
FT                   PLPPVEDNRSFIEKLFDLPPASSPGLAYAALESNPVVPAPNRRLSPVPGPDVARATAVY
FT                   DISARTVTLPNGERLEAHSGLGPHMDDPRFVHVRMRGATPPGTYDLTEREKLFHGVRAI
FT                   RLTPVGGSGAVHGRVGLLAHTYMLGPSGASNGCVSFKDYNRFLQAFLRGEVQRLVVVAG
FT                   RGQDGPPGTNDRRIGLSDRPAAGGNGA"
     MPIALSFPLH GGWGLADLGA FGHAERDGRP TALGRRARET STVAGLQMVL DPPSASAAAA        60
     TRPARRAGPL AASLIALLSL TVSGDWHPAE APPAPTGSRG QAEAPPAPVE EAPPAVTRAD       120
     AAPAPPVQGL SVETPVPWQS ALLDSVLEAA LAPPSDPVEA PASETPDEAR TAAPDDLSQD       180
     PARLAQPVPL PVPRPPELRR PRTAEPARGA SRSAAQRAGV ASPLPPVEDN RSFIEKLFDL       240
     PPASSPGLAY AALESNPVVP APNRRLSPVP GPDVARATAV YDISARTVTL PNGERLEAHS       300
     GLGPHMDDPR FVHVRMRGAT PPGTYDLTER EKLFHGVRAI RLTPVGGSGA VHGRVGLLAH       360
     TYMLGPSGAS NGCVSFKDYN RFLQAFLRGE VQRLVVVAGR GQDGPPGTND RRIGLSDRPA       420
     AGGNGA                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page