(data stored in ACNUC7421 zone)

EMBL: CP001349.PE421

CP001349.PE421       Location/Qualifiers
FT   CDS             complement(486561..487358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55473"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC85"
FT                   /inference="similar to AA sequence:KEGG:M446_2079"
FT                   /protein_id="ACL55473.1"
FT                   /translation="MINCGYGRPLVAAGFAAFVFTAHAAQAAQCGNGPAGFEAWKREFA
FT                   EEARGRVGATGVSALMGTSYSSATIAADRGQKSFRLSLDQFLAKRGGPAIVSRGRALKQ
FT                   SNAALFASIEQRYGVPPGPLLAIWGMETGFGASRGNVNTLSAVATLAYDCRRSAYFTDQ
FT                   LYAALTLVDRGILSPSTRGAAHGEVGHTQFLPKSILNYGTGGSLDSVPNALNATANFLR
FT                   AHGWQRGAGYQPGEPNFSAIQGWNSASVYQRAIALIGRRIDGE"
     MINCGYGRPL VAAGFAAFVF TAHAAQAAQC GNGPAGFEAW KREFAEEARG RVGATGVSAL        60
     MGTSYSSATI AADRGQKSFR LSLDQFLAKR GGPAIVSRGR ALKQSNAALF ASIEQRYGVP       120
     PGPLLAIWGM ETGFGASRGN VNTLSAVATL AYDCRRSAYF TDQLYAALTL VDRGILSPST       180
     RGAAHGEVGH TQFLPKSILN YGTGGSLDSV PNALNATANF LRAHGWQRGA GYQPGEPNFS       240
     AIQGWNSASV YQRAIALIGR RIDGE                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page