(data stored in ACNUC7421 zone)

EMBL: CP001349.PE422

CP001349.PE422       Location/Qualifiers
FT   CDS             487696..488814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0432"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; Male sterility domain; KR domain
FT                   protein; KEGG: met:M446_2078 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55474"
FT                   /db_xref="GOA:B8IC86"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC86"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55474.1"
FT                   /translation="MSQSILITGGAGFIGRAVARALVARGDRVRVLDSLIDQVHGGLGR
FT                   PDDLPDAVDLRRGDVRDPAAVAQSLIGIDKVIHLAAEVGVGQSMYAVERYVSVNDLGTA
FT                   VLFQALIERPVQRVVVASSMSVYGEGLYRDSEGALIEDVARQPRSGPEAPWDPLDARGR
FT                   PLKPVPTPEWKRPALASVYALSKYAQERLTLMLAPAYGMEGVALRLWNAYGPGQALSNP
FT                   YTGVLAIFASRLHNGAAPVIFEDGHQLRDFVQVDDVAQAFLLALDRREAAGQVYNIGSG
FT                   EYRSVREVATLLARAMGRTDIVPEIAGKMRAGDIRHCIPDIGKAKAELGYAPRRDFADG
FT                   LAELAAWVAAQQDAQDRVAEARRELEKRGLVA"
     MSQSILITGG AGFIGRAVAR ALVARGDRVR VLDSLIDQVH GGLGRPDDLP DAVDLRRGDV        60
     RDPAAVAQSL IGIDKVIHLA AEVGVGQSMY AVERYVSVND LGTAVLFQAL IERPVQRVVV       120
     ASSMSVYGEG LYRDSEGALI EDVARQPRSG PEAPWDPLDA RGRPLKPVPT PEWKRPALAS       180
     VYALSKYAQE RLTLMLAPAY GMEGVALRLW NAYGPGQALS NPYTGVLAIF ASRLHNGAAP       240
     VIFEDGHQLR DFVQVDDVAQ AFLLALDRRE AAGQVYNIGS GEYRSVREVA TLLARAMGRT       300
     DIVPEIAGKM RAGDIRHCIP DIGKAKAELG YAPRRDFADG LAELAAWVAA QQDAQDRVAE       360
     ARRELEKRGL VA                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page