(data stored in ACNUC7421 zone)

EMBL: CP001349.PE423

CP001349.PE423       Location/Qualifiers
FT   CDS             488811..489905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0433"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: met:M446_2077 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55475"
FT                   /db_xref="GOA:B8IC87"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC87"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55475.1"
FT                   /translation="MTSPGGLRPILITGGAGFIGANLADALAAEGRDVLIYDALLRPGV
FT                   EANLDWLKRRHPDRISAVVADVRDTAALAAAAGDAAAVFHFAAQVAVTTSLVEPATDFD
FT                   VNLGATLQLLEALRRRPDPAPLIFASTNKVYGDLADLAFRREGEAYRPADETLHRHGIG
FT                   EDRPLDFHTPYGCSKGGADQYVLDYARSFGVPTCVMRMSCIYGPRQMGTEDQGWVAHFL
FT                   IRALAEQPIAIYGDGYQVRDILHVADAVAAYRAALARIGQVSGRAYNLGGGPANAVSLR
FT                   QVLGAIRDLVAQPLDLSFHDWRAGDQRYYVSDTRRAAADLGLDAPIAWRTGLRDLARWL
FT                   AEARGLVLPEESAPRRLAASVSSA"
     MTSPGGLRPI LITGGAGFIG ANLADALAAE GRDVLIYDAL LRPGVEANLD WLKRRHPDRI        60
     SAVVADVRDT AALAAAAGDA AAVFHFAAQV AVTTSLVEPA TDFDVNLGAT LQLLEALRRR       120
     PDPAPLIFAS TNKVYGDLAD LAFRREGEAY RPADETLHRH GIGEDRPLDF HTPYGCSKGG       180
     ADQYVLDYAR SFGVPTCVMR MSCIYGPRQM GTEDQGWVAH FLIRALAEQP IAIYGDGYQV       240
     RDILHVADAV AAYRAALARI GQVSGRAYNL GGGPANAVSL RQVLGAIRDL VAQPLDLSFH       300
     DWRAGDQRYY VSDTRRAAAD LGLDAPIAWR TGLRDLARWL AEARGLVLPE ESAPRRLAAS       360
     VSSA                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page