(data stored in ACNUC7421 zone)

EMBL: CP001349.PE424

CP001349.PE424       Location/Qualifiers
FT   CDS             490003..491301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0434"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: met:M446_2076 radical SAM
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55476"
FT                   /db_xref="GOA:B8IC88"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR027559"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC88"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACL55476.1"
FT                   /translation="MRISLVNPTWTFTQSIYFGCREPHLPIELGACKVLLEAAGHDVLM
FT                   LDGALDGLSLEELADRVADFRPAMTVVTTAPTYLFWRCAQPELRVPRAFLDALGERGGR
FT                   TVVVGPHGSVTPETALTKLGCDFVVRGECEEVVAALASGGLERPDRVPALAYRDGLEIT
FT                   VTGGPAAARFADLPALSWPEAWIARHHHHHHRFDRAPDGPGAEVEASRGCPYTCTFCAK
FT                   IDFRDKYRRRDLTIILEEIDRLIAQGVTYLYFIDEIFLPQKPLLEALVGRAVSFGVQTR
FT                   IDLWKPDMLDLLGAAGCVSIEAGVESLTEEGRALLDKNCRVSTDDLAERLIHARRSVPF
FT                   VQANLIKVAGDDPALVAAWRERLQAAGVWANDPVPLYPYPSSPDYRRLWGEPDGRAWER
FT                   AHAHYLAEFDRFSDIQDERPAPLTELESACCPA"
     MRISLVNPTW TFTQSIYFGC REPHLPIELG ACKVLLEAAG HDVLMLDGAL DGLSLEELAD        60
     RVADFRPAMT VVTTAPTYLF WRCAQPELRV PRAFLDALGE RGGRTVVVGP HGSVTPETAL       120
     TKLGCDFVVR GECEEVVAAL ASGGLERPDR VPALAYRDGL EITVTGGPAA ARFADLPALS       180
     WPEAWIARHH HHHHRFDRAP DGPGAEVEAS RGCPYTCTFC AKIDFRDKYR RRDLTIILEE       240
     IDRLIAQGVT YLYFIDEIFL PQKPLLEALV GRAVSFGVQT RIDLWKPDML DLLGAAGCVS       300
     IEAGVESLTE EGRALLDKNC RVSTDDLAER LIHARRSVPF VQANLIKVAG DDPALVAAWR       360
     ERLQAAGVWA NDPVPLYPYP SSPDYRRLWG EPDGRAWERA HAHYLAEFDR FSDIQDERPA       420
     PLTELESACC PA                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page