(data stored in ACNUC7421 zone)

EMBL: CP001349.PE425

CP001349.PE425       Location/Qualifiers
FT   CDS             491286..492446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0435"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   met:M446_2075 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55477"
FT                   /db_xref="GOA:B8IC89"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC89"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACL55477.1"
FT                   /translation="MLPGLTAARPRAPSLNLFMTADAVGGVWQYALDLCLDLERRGLGI
FT                   TLAVLGPEPSVDQLRAARAIRGLDLRVMDVPLDWTALTRSEVETAAWRVAREAERAGAD
FT                   LVHLNSPALAAIALFPVPIVAVAHSCVATWWASMRGGPLPPDLAWRAALAGEGYRRAAA
FT                   VLSPTRAFAEATAATYALPALPWVVPNGRRSPAERGHRTPRGAAASPFAFTAGRLWDEG
FT                   KNAATLDRVAARLAPRPFLAAGPLDGPNAACFAPRHLRCLGRLTDQDMARWLAGAPIYV
FT                   SAARYEPFGLGVLEAASAACALVLSDIPTFRELWDDAAIFIDPDDDAGFAAAIELVAGD
FT                   PAIRARLGAEAKVRADALTVEAMGAGVLAAYQAVLGETPRRAGAPA"
     MLPGLTAARP RAPSLNLFMT ADAVGGVWQY ALDLCLDLER RGLGITLAVL GPEPSVDQLR        60
     AARAIRGLDL RVMDVPLDWT ALTRSEVETA AWRVAREAER AGADLVHLNS PALAAIALFP       120
     VPIVAVAHSC VATWWASMRG GPLPPDLAWR AALAGEGYRR AAAVLSPTRA FAEATAATYA       180
     LPALPWVVPN GRRSPAERGH RTPRGAAASP FAFTAGRLWD EGKNAATLDR VAARLAPRPF       240
     LAAGPLDGPN AACFAPRHLR CLGRLTDQDM ARWLAGAPIY VSAARYEPFG LGVLEAASAA       300
     CALVLSDIPT FRELWDDAAI FIDPDDDAGF AAAIELVAGD PAIRARLGAE AKVRADALTV       360
     EAMGAGVLAA YQAVLGETPR RAGAPA                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page