(data stored in ACNUC7421 zone)

EMBL: CP001349.PE426

CP001349.PE426       Location/Qualifiers
FT   CDS             492443..493555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55478"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC90"
FT                   /inference="similar to AA sequence:KEGG:M446_2074"
FT                   /protein_id="ACL55478.1"
FT                   /translation="MRIVVFTHSLRSCWNHGNAHFLRGTLRELIALGHDVAVHEPAGAW
FT                   SLANLVADHGEAGAAASLGPYPELSSRIDPPGFDPAEALDGADLVLVHEWNEPALVARI
FT                   GALRKAGGRFTLLFHDTHHRAVSEPAAMRAYDLSGYDGVLAFGETLAAVYRGWGWGSCV
FT                   FVWHEAADTRLFRPPAQETGRAGLVWIGNWGDGERSAELESFLFRPARDAGLSLDVWGV
FT                   RYPDEARAALDRYGARYRGWLPNARAPEVFARHLATIHVPRRFYVEALPGIPTIRVFEA
FT                   LACGIPLVSAPWRDSEGLFTPGRDFLMAGDEAAMGRHLRALRDDPALRAEIAAHGLATI
FT                   RARHTCAHRAAELMAVAERLAGPLSLKAAG"
     MRIVVFTHSL RSCWNHGNAH FLRGTLRELI ALGHDVAVHE PAGAWSLANL VADHGEAGAA        60
     ASLGPYPELS SRIDPPGFDP AEALDGADLV LVHEWNEPAL VARIGALRKA GGRFTLLFHD       120
     THHRAVSEPA AMRAYDLSGY DGVLAFGETL AAVYRGWGWG SCVFVWHEAA DTRLFRPPAQ       180
     ETGRAGLVWI GNWGDGERSA ELESFLFRPA RDAGLSLDVW GVRYPDEARA ALDRYGARYR       240
     GWLPNARAPE VFARHLATIH VPRRFYVEAL PGIPTIRVFE ALACGIPLVS APWRDSEGLF       300
     TPGRDFLMAG DEAAMGRHLR ALRDDPALRA EIAAHGLATI RARHTCAHRA AELMAVAERL       360
     AGPLSLKAAG                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page