(data stored in ACNUC7421 zone)

EMBL: CP001349.PE427

CP001349.PE427       Location/Qualifiers
FT   CDS             493641..494738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55479"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC91"
FT                   /inference="similar to AA sequence:KEGG:M446_2073"
FT                   /protein_id="ACL55479.1"
FT                   /translation="MSTIAFYGSSLLSSYWNGAATYYRGLIRDLARRGWRTTFYEPDAF
FT                   DRQRHRDIDPPDWASVTVYPATEEAARAVIAQAARADVVVKASGVGVFDDLLLAGVTAA
FT                   ARPDAVRLFWDVDAPATLAELRTAPDHPLRRTLPALDLVLTYGGGPPVVEAYEEFGARR
FT                   CVPVYNALDPDTHHPVPADPRFAADLSFLGNRLPDREARVDEFFLRPAERLPDRAFLIG
FT                   GNGWDSRALPANVRHIGHVSTRDHNAFNVTPRAVLNIARDSMAATGWSPATRVFEAAGA
FT                   GACLITDAWVGLDMFLKADEEVLVARDGADVAEHVAALTPQRAASIGAAGRRRILAEHT
FT                   YARRGAEVDAILRAALASRRARSVA"
     MSTIAFYGSS LLSSYWNGAA TYYRGLIRDL ARRGWRTTFY EPDAFDRQRH RDIDPPDWAS        60
     VTVYPATEEA ARAVIAQAAR ADVVVKASGV GVFDDLLLAG VTAAARPDAV RLFWDVDAPA       120
     TLAELRTAPD HPLRRTLPAL DLVLTYGGGP PVVEAYEEFG ARRCVPVYNA LDPDTHHPVP       180
     ADPRFAADLS FLGNRLPDRE ARVDEFFLRP AERLPDRAFL IGGNGWDSRA LPANVRHIGH       240
     VSTRDHNAFN VTPRAVLNIA RDSMAATGWS PATRVFEAAG AGACLITDAW VGLDMFLKAD       300
     EEVLVARDGA DVAEHVAALT PQRAASIGAA GRRRILAEHT YARRGAEVDA ILRAALASRR       360
     ARSVA                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page