(data stored in ACNUC7421 zone)

EMBL: CP001349.PE428

CP001349.PE428       Location/Qualifiers
FT   CDS             494735..495883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55480"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC92"
FT                   /inference="similar to AA sequence:KEGG:M446_2072"
FT                   /protein_id="ACL55480.1"
FT                   /translation="MSRPLDLVVLGLSLSSSWGNGHATTYRALLKAFAARGHRVTFLER
FT                   DVPWYAAHRDLADPDYCELILYPDLASLKDLRPRLLRADAAIVGSYVPDGVAVGRWAIA
FT                   AMREAGGVAAFYDIDTPVTLAKLARGDHEYLTPDLIRAYDLYLSFTGGPVLARLEREHG
FT                   SPLARALYCSVDPAHYTPGGAKPSYDLSYLGTYSPDRQPTLERLLIEPARRAPHLRFVV
FT                   AGPQYPADIAWPANVERREHVGPADHPAFYAASRWTLNVTRADMREAGYSPSVRLFEAA
FT                   ACGTPILSDAWPGLDTILTPGREIVAADGPEAVLRALTETPEPDRAALARAARRRVLAA
FT                   HSAAHRATELEAALGEARARAAQKYPQHVWKLGFSERVGERR"
     MSRPLDLVVL GLSLSSSWGN GHATTYRALL KAFAARGHRV TFLERDVPWY AAHRDLADPD        60
     YCELILYPDL ASLKDLRPRL LRADAAIVGS YVPDGVAVGR WAIAAMREAG GVAAFYDIDT       120
     PVTLAKLARG DHEYLTPDLI RAYDLYLSFT GGPVLARLER EHGSPLARAL YCSVDPAHYT       180
     PGGAKPSYDL SYLGTYSPDR QPTLERLLIE PARRAPHLRF VVAGPQYPAD IAWPANVERR       240
     EHVGPADHPA FYAASRWTLN VTRADMREAG YSPSVRLFEA AACGTPILSD AWPGLDTILT       300
     PGREIVAADG PEAVLRALTE TPEPDRAALA RAARRRVLAA HSAAHRATEL EAALGEARAR       360
     AAQKYPQHVW KLGFSERVGE RR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page