(data stored in ACNUC7421 zone)

EMBL: CP001349.PE429

CP001349.PE429       Location/Qualifiers
FT   CDS             495942..496964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0439"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: met:M446_2071 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55481"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC93"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55481.1"
FT                   /translation="MTNRKSPTVLVAGGAGFLGSHLCEALLARGDRVICLDNFLTGRRR
FT                   NLRHLEREPRFELIEHDVVRPLPASLRRRPFERIYNLACAASPPHYQADPEHTLLTSVL
FT                   GARHLLMLAEAAGASLLQASTSEIYGDPEVHPQAEAYWGHVNPTGPRACYDEGKRAAET
FT                   LCYDYARAGRVAVRVARIFNTYGPRMRADDGRVVSNVVCQALAGDDITVYGDGSQTRSF
FT                   CYVADLIDGLVRLMAHEAPGFAVPPVNLGNPVELTVSDLVQRVLAMTGSPSAIVTRPLP
FT                   TDDPRRRRPDIARAQELLGWAPKVPLDQGLKATILWFADEAEDGPRGVVVPEERRAVLV
FT                   "
     MTNRKSPTVL VAGGAGFLGS HLCEALLARG DRVICLDNFL TGRRRNLRHL EREPRFELIE        60
     HDVVRPLPAS LRRRPFERIY NLACAASPPH YQADPEHTLL TSVLGARHLL MLAEAAGASL       120
     LQASTSEIYG DPEVHPQAEA YWGHVNPTGP RACYDEGKRA AETLCYDYAR AGRVAVRVAR       180
     IFNTYGPRMR ADDGRVVSNV VCQALAGDDI TVYGDGSQTR SFCYVADLID GLVRLMAHEA       240
     PGFAVPPVNL GNPVELTVSD LVQRVLAMTG SPSAIVTRPL PTDDPRRRRP DIARAQELLG       300
     WAPKVPLDQG LKATILWFAD EAEDGPRGVV VPEERRAVLV                             340
//

If you have problems or comments...

PBIL Back to PBIL home page