(data stored in ACNUC7421 zone)

EMBL: CP001349.PE43

CP001349.PE43        Location/Qualifiers
FT   CDS             complement(47783..49618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0044"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region
FT                   ATPase domain protein; KEGG: met:M446_0044 heat shock
FT                   protein HSP90"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55095"
FT                   /db_xref="GOA:B8IU50"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IU50"
FT                   /inference="protein motif:PFAM:PF00183"
FT                   /protein_id="ACL55095.1"
FT                   /translation="MSETLERHAFGAEVGRLLDLVVHALYSEREIFLRELVANAADAVD
FT                   RRRFGALTDPALALPAEAKVRIRPDKAARTLTISDPGIGMGKEDLAQNLGTIARSGTRA
FT                   FSQSLAEAKPDERPSLIGQFGVGFYSAFMVADRVEVTSRRAGSDEAWTWASDGEGEYTL
FT                   SPATREEPGTDVVLHMKADADEYLEPLRIETIVRKWADHITVPITLLRDGEEVSGNEGT
FT                   ALWRKPKAEITEETYTAFYRHLTHNFDTPWATLHWRAEGALDFSALLFIPSMKPFLAVE
FT                   EERESKVRLHVRRMFITDEAGLLPSWLRFVQGVVDTEDLPLNVSREMLQATPVLARIRR
FT                   AVTAKVLSELKSRAKDADGYASFWQAFGPVLKEGIWEDAEQRDDIAGLIRFRSSAVEGW
FT                   TSFADYVSRMKPNQEAIYILVGDDTKALASSAQIEGFRARGIEVLLLSDHVDAFWPERL
FT                   DKFDGKPIRSITQSADDLSAFAPEGESEGEAADLADLVPKLKEILKDDVTDVRASQRLV
FT                   ESAVLLSASSGGPDLQMQRLLRRAGRGFGAGLPVLELNPRHALVRRLAERAKTGEDIAE
FT                   AAQTLLDLAHVQGGDAPRDPVAFARRVATALAAQG"
     MSETLERHAF GAEVGRLLDL VVHALYSERE IFLRELVANA ADAVDRRRFG ALTDPALALP        60
     AEAKVRIRPD KAARTLTISD PGIGMGKEDL AQNLGTIARS GTRAFSQSLA EAKPDERPSL       120
     IGQFGVGFYS AFMVADRVEV TSRRAGSDEA WTWASDGEGE YTLSPATREE PGTDVVLHMK       180
     ADADEYLEPL RIETIVRKWA DHITVPITLL RDGEEVSGNE GTALWRKPKA EITEETYTAF       240
     YRHLTHNFDT PWATLHWRAE GALDFSALLF IPSMKPFLAV EEERESKVRL HVRRMFITDE       300
     AGLLPSWLRF VQGVVDTEDL PLNVSREMLQ ATPVLARIRR AVTAKVLSEL KSRAKDADGY       360
     ASFWQAFGPV LKEGIWEDAE QRDDIAGLIR FRSSAVEGWT SFADYVSRMK PNQEAIYILV       420
     GDDTKALASS AQIEGFRARG IEVLLLSDHV DAFWPERLDK FDGKPIRSIT QSADDLSAFA       480
     PEGESEGEAA DLADLVPKLK EILKDDVTDV RASQRLVESA VLLSASSGGP DLQMQRLLRR       540
     AGRGFGAGLP VLELNPRHAL VRRLAERAKT GEDIAEAAQT LLDLAHVQGG DAPRDPVAFA       600
     RRVATALAAQ G                                                            611
//

If you have problems or comments...

PBIL Back to PBIL home page