(data stored in ACNUC7421 zone)

EMBL: CP001349.PE431

CP001349.PE431       Location/Qualifiers
FT   CDS             complement(497728..498585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0441"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: met:M446_2069 LmbE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55483"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC95"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ACL55483.1"
FT                   /translation="MSAVVTGPLAPTSPEAEAFLTALAHPARGPVRAGHAALVVAHPDD
FT                   ESIGCGAQLPRLAGLAVIHVTDGAPRSGPDAARHGFADPTAYAAARARELDAALTLARV
FT                   PPERRLALGLPDQGVAEALAALARRLAEIFAARGITLALTHAYEGGHPDHDAVALAVQG
FT                   AKRLMGGALAVIEMPYYHRGAQGPEAGAFLPTQPPRRAIALHLDPEDCALKADLFAAHA
FT                   TQAAILNRLPIALERFREAPAYRFDTLPNEGRLLYEEWQLGLNGARFLDLARAAEREIA
FT                   GLCP"
     MSAVVTGPLA PTSPEAEAFL TALAHPARGP VRAGHAALVV AHPDDESIGC GAQLPRLAGL        60
     AVIHVTDGAP RSGPDAARHG FADPTAYAAA RARELDAALT LARVPPERRL ALGLPDQGVA       120
     EALAALARRL AEIFAARGIT LALTHAYEGG HPDHDAVALA VQGAKRLMGG ALAVIEMPYY       180
     HRGAQGPEAG AFLPTQPPRR AIALHLDPED CALKADLFAA HATQAAILNR LPIALERFRE       240
     APAYRFDTLP NEGRLLYEEW QLGLNGARFL DLARAAEREI AGLCP                       285
//

If you have problems or comments...

PBIL Back to PBIL home page