(data stored in ACNUC7421 zone)

EMBL: CP001349.PE432

CP001349.PE432       Location/Qualifiers
FT   CDS             complement(498582..499517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55484"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024655"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC96"
FT                   /inference="similar to AA sequence:KEGG:M446_2068"
FT                   /protein_id="ACL55484.1"
FT                   /translation="MIEAAMIWNEPNNKSHWDPEIDPGWHLFADTLACAAQALKQEAPA
FT                   LPTVLGGLSPIDPTFVQFLDSKRALDHVDVVAVHGFPLDWNLWQINEWPAKLAEIRAVT
FT                   PKPVWVTEVGVSTFGAEEVQVFGLERTAALLIGRTPRIHWYSLYDLPQAWGATTRHKEA
FT                   EGSSYYRHFYMGLLREDGTPKPALEQFGRYAPAMGLCQWFHFEDHRLDDAVAWMRRLGV
FT                   RYLRTGLSWADSFRPNALDWFDRQMEALAEFDVTVTFCFTPEHRGIAPHHTSPPQVKEE
FT                   FAEFCTAMIRRYAGQLRPRSDALAMPASLA"
     MIEAAMIWNE PNNKSHWDPE IDPGWHLFAD TLACAAQALK QEAPALPTVL GGLSPIDPTF        60
     VQFLDSKRAL DHVDVVAVHG FPLDWNLWQI NEWPAKLAEI RAVTPKPVWV TEVGVSTFGA       120
     EEVQVFGLER TAALLIGRTP RIHWYSLYDL PQAWGATTRH KEAEGSSYYR HFYMGLLRED       180
     GTPKPALEQF GRYAPAMGLC QWFHFEDHRL DDAVAWMRRL GVRYLRTGLS WADSFRPNAL       240
     DWFDRQMEAL AEFDVTVTFC FTPEHRGIAP HHTSPPQVKE EFAEFCTAMI RRYAGQLRPR       300
     SDALAMPASL A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page