(data stored in ACNUC7421 zone)

EMBL: CP001349.PE433

CP001349.PE433       Location/Qualifiers
FT   CDS             499683..500642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0443"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mpo:Mpop_2285
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55485"
FT                   /db_xref="GOA:B8IC97"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC97"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACL55485.1"
FT                   /translation="MQLTGIHHLTAVTAQAADNFAFYTRVLGQRLVKKTVNQDDVSAFH
FT                   LFYGDGVASPGSDLTFFDWPAPRERRGTNSIARTLLRVAGPEAIAWWREHLGRQGVSHR
FT                   LPVERDGRLTLDFEDPEGQRLGLVDDGGAGEAHPWAGSPVPAEHQIRGLGPILLSVADP
FT                   AATEAVLTGVLGMRPMREYPAGDAAAERSAERPVRVYAMGAGGPAAELHVVAEPDLGPA
FT                   RPGAGGVHHVAFRIPDAAYEAWADRLRTLRVPSSGPVDRYYFRSLYFREPNGILFEIAT
FT                   DGPGFATDEPLDRLGERLALPPFLEPRRAQIEAGLKPL"
     MQLTGIHHLT AVTAQAADNF AFYTRVLGQR LVKKTVNQDD VSAFHLFYGD GVASPGSDLT        60
     FFDWPAPRER RGTNSIARTL LRVAGPEAIA WWREHLGRQG VSHRLPVERD GRLTLDFEDP       120
     EGQRLGLVDD GGAGEAHPWA GSPVPAEHQI RGLGPILLSV ADPAATEAVL TGVLGMRPMR       180
     EYPAGDAAAE RSAERPVRVY AMGAGGPAAE LHVVAEPDLG PARPGAGGVH HVAFRIPDAA       240
     YEAWADRLRT LRVPSSGPVD RYYFRSLYFR EPNGILFEIA TDGPGFATDE PLDRLGERLA       300
     LPPFLEPRRA QIEAGLKPL                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page