(data stored in ACNUC7421 zone)

EMBL: CP001349.PE434

CP001349.PE434       Location/Qualifiers
FT   CDS             complement(500753..501379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0444"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /note="TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase; KEGG: met:M446_2067
FT                   phosphoglycerate mutase 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55486"
FT                   /db_xref="GOA:B8IC98"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC98"
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /protein_id="ACL55486.1"
FT                   /translation="MERLLVLARHGQSEWNLKNLFTGWRDPDLTEIGVAEARAAGRRLK
FT                   AKGIRFDVAFTSALTRAQRTAELILEELGQPDLPTIADAALNERDYGDLSGLNKDDARE
FT                   RWGKEQVHVWRRSYDVPPPGGESLKDTVARVLPYTMREILPRVMRGERVLVAAHGNSLR
FT                   ALVMVLDGLTTETIPGLELWTGVPLVYHLKADTTVESKEVLDKDV"
     MERLLVLARH GQSEWNLKNL FTGWRDPDLT EIGVAEARAA GRRLKAKGIR FDVAFTSALT        60
     RAQRTAELIL EELGQPDLPT IADAALNERD YGDLSGLNKD DARERWGKEQ VHVWRRSYDV       120
     PPPGGESLKD TVARVLPYTM REILPRVMRG ERVLVAAHGN SLRALVMVLD GLTTETIPGL       180
     ELWTGVPLVY HLKADTTVES KEVLDKDV                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page