(data stored in ACNUC7421 zone)

EMBL: CP001349.PE435

CP001349.PE435       Location/Qualifiers
FT   CDS             complement(501411..502208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0445"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   met:M446_2066 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55487"
FT                   /db_xref="GOA:B8IC99"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC99"
FT                   /inference="protein motif:PFAM:PF01113"
FT                   /protein_id="ACL55487.1"
FT                   /translation="MRLVVVGASGRMGRMLIQTVVGTEGCTLAGAVAREGSAAIGEDAG
FT                   VLAGLPPLGLAVTDDPLRAFAEADGVLDFTAPATTVFYAELAAQARLVHVVGTTGLSAD
FT                   DLKKLDAASRHARIVRSGNMSLGVNLLAGLVRKVAATLGEEFDIEILEMHHRHKVDAPS
FT                   GTALLLGKAAAEGRAVALAERKVAVRDGHTGARVPGTIGFATLRGGSVVGEHSVIFAGA
FT                   GERIELTHRAEDRGIFARGAVRAALWAFPQKPGLYDMDDVLGL"
     MRLVVVGASG RMGRMLIQTV VGTEGCTLAG AVAREGSAAI GEDAGVLAGL PPLGLAVTDD        60
     PLRAFAEADG VLDFTAPATT VFYAELAAQA RLVHVVGTTG LSADDLKKLD AASRHARIVR       120
     SGNMSLGVNL LAGLVRKVAA TLGEEFDIEI LEMHHRHKVD APSGTALLLG KAAAEGRAVA       180
     LAERKVAVRD GHTGARVPGT IGFATLRGGS VVGEHSVIFA GAGERIELTH RAEDRGIFAR       240
     GAVRAALWAF PQKPGLYDMD DVLGL                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page