(data stored in ACNUC7421 zone)

EMBL: CP001349.PE437

CP001349.PE437       Location/Qualifiers
FT   CDS             complement(503060..503800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0447"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: met:M446_2064
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55489"
FT                   /db_xref="GOA:B8ICA1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL55489.1"
FT                   /translation="MSVDVTDLRAFYSGPLGAVTQRLVGRTVHRFLGSVAGLRVLGLGY
FT                   AVPYLGPVRHAAERTLAFMPAMQGVVNWPATGRSASALVDPTMMPLPEAAVDRVILVHA
FT                   IEAVESPAELLQEVWRVLTPGGRLVLVVPNRRGLWARRDATPFGHGQPYSRSQLGRLMR
FT                   ETLFSPEGWAETLYVPPVEGWITLRTASAWERVGTSLSLPFAGLHVVDAIKQLHRPVTV
FT                   QARRAARLRAPVLVPAPAPVPGGV"
     MSVDVTDLRA FYSGPLGAVT QRLVGRTVHR FLGSVAGLRV LGLGYAVPYL GPVRHAAERT        60
     LAFMPAMQGV VNWPATGRSA SALVDPTMMP LPEAAVDRVI LVHAIEAVES PAELLQEVWR       120
     VLTPGGRLVL VVPNRRGLWA RRDATPFGHG QPYSRSQLGR LMRETLFSPE GWAETLYVPP       180
     VEGWITLRTA SAWERVGTSL SLPFAGLHVV DAIKQLHRPV TVQARRAARL RAPVLVPAPA       240
     PVPGGV                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page