(data stored in ACNUC7421 zone)

EMBL: CP001349.PE438

CP001349.PE438       Location/Qualifiers
FT   CDS             504007..504774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0448"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="TIGRFAM: hydroxyacylglutathione hydrolase; PFAM:
FT                   beta-lactamase domain protein; KEGG: met:M446_2063
FT                   hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55490"
FT                   /db_xref="GOA:B8ICA2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8ICA2"
FT                   /inference="protein motif:TFAM:TIGR03413"
FT                   /protein_id="ACL55490.1"
FT                   /translation="MPEIRTFLCRSDNIGVLLHDPVTSACAAIDVPEAGAVLRALKETG
FT                   WRLTDILVTHRHFDHVEGIPEVKARTGARVTAPAKAGDAVPEVDATVREGDVVKVGSLV
FT                   GTVWETPGHCADHVTYWFERERLAFAGDTLFTLGCGRVMESPPEVLWRSLSRFLALPDE
FT                   TAIYSGHDYVLSNARFALAADPDNSNLKARAELAERVKRDGRFLIPTTLGEEKATNPFL
FT                   RAGEPALARSVDMAPGSDPAAVFAALREWKNRF"
     MPEIRTFLCR SDNIGVLLHD PVTSACAAID VPEAGAVLRA LKETGWRLTD ILVTHRHFDH        60
     VEGIPEVKAR TGARVTAPAK AGDAVPEVDA TVREGDVVKV GSLVGTVWET PGHCADHVTY       120
     WFERERLAFA GDTLFTLGCG RVMESPPEVL WRSLSRFLAL PDETAIYSGH DYVLSNARFA       180
     LAADPDNSNL KARAELAERV KRDGRFLIPT TLGEEKATNP FLRAGEPALA RSVDMAPGSD       240
     PAAVFAALRE WKNRF                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page