(data stored in ACNUC7421 zone)

EMBL: CP001349.PE439

CP001349.PE439       Location/Qualifiers
FT   CDS             504934..505380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0449"
FT                   /product="protein of unknown function DUF985"
FT                   /note="PFAM: protein of unknown function DUF985; KEGG:
FT                   met:M446_2062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55491"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA3"
FT                   /inference="protein motif:PFAM:PF06172"
FT                   /protein_id="ACL55491.1"
FT                   /translation="MTSSPSLTAAEVVRLLDLKPHPEGGHFRETFRDPREIDGRAASTA
FT                   IYYLLDVGETSEWHRVDAAEIWLWHAGAPLVLTVSPNGHDAEARHLGPDLARGQRPQIV
FT                   VPAGHWQTATSLGAWTLVSCTVAPGFRFEGFELAPPNWRPMPRG"
     MTSSPSLTAA EVVRLLDLKP HPEGGHFRET FRDPREIDGR AASTAIYYLL DVGETSEWHR        60
     VDAAEIWLWH AGAPLVLTVS PNGHDAEARH LGPDLARGQR PQIVVPAGHW QTATSLGAWT       120
     LVSCTVAPGF RFEGFELAPP NWRPMPRG                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page