(data stored in ACNUC7421 zone)

EMBL: CP001349.PE44

CP001349.PE44        Location/Qualifiers
FT   CDS             complement(49702..50373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0045"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: met:M446_0045 exonuclease RNase T
FT                   and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55096"
FT                   /db_xref="GOA:B8IU51"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU51"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ACL55096.1"
FT                   /translation="MWRGLIRRIDRARLTDPRFAFLFAPSPADEAVALDCETTGLDPRR
FT                   DEIVAVAAIRIRGDRILTSESFRATVQSQRPSSPEAIKVHRLLEAEIRQGMPHDVMLPE
FT                   LLRFIGSRPVVGYYTDFDVGMVDKYARRILRIRLPNPRIDVSALYYACKYRDAPDYVKI
FT                   DLSFARIAADLGLPALPQHDAFNDALMTAMMYVQLRDMLERRASIPRTGTEPVESAAFG
FT                   A"
     MWRGLIRRID RARLTDPRFA FLFAPSPADE AVALDCETTG LDPRRDEIVA VAAIRIRGDR        60
     ILTSESFRAT VQSQRPSSPE AIKVHRLLEA EIRQGMPHDV MLPELLRFIG SRPVVGYYTD       120
     FDVGMVDKYA RRILRIRLPN PRIDVSALYY ACKYRDAPDY VKIDLSFARI AADLGLPALP       180
     QHDAFNDALM TAMMYVQLRD MLERRASIPR TGTEPVESAA FGA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page