(data stored in ACNUC7421 zone)

EMBL: CP001349.PE440

CP001349.PE440       Location/Qualifiers
FT   CDS             complement(505587..506471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0450"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: met:M446_2060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55492"
FT                   /db_xref="GOA:B8ICA4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL55492.1"
FT                   /translation="MTVRTATLTGSGAILLWSLLALFTAASGAVPPFQLAAMTFLIGGL
FT                   LGCASWIVRPSGVAALRQKPAVWALGLAGLFGYHALYFAALRLAPPAEAGLISYLWPLL
FT                   IVLFSALLPGEGGLRAPHLVGALLGLSGVVTLFLGRGTLSFEAAALPGYLAALACAFLW
FT                   SGYSVLSRRVGAVPTDAVAGFCLATAALSLLCHLAFETTIWPATVSEWAAVAALGLGPV
FT                   GAAFYLWDIGVKRGDIRLLGVGSYAAPVLSTLILVAAGYAPATLSLALACGLIVAGALV
FT                   ATRAGAEKRERVA"
     MTVRTATLTG SGAILLWSLL ALFTAASGAV PPFQLAAMTF LIGGLLGCAS WIVRPSGVAA        60
     LRQKPAVWAL GLAGLFGYHA LYFAALRLAP PAEAGLISYL WPLLIVLFSA LLPGEGGLRA       120
     PHLVGALLGL SGVVTLFLGR GTLSFEAAAL PGYLAALACA FLWSGYSVLS RRVGAVPTDA       180
     VAGFCLATAA LSLLCHLAFE TTIWPATVSE WAAVAALGLG PVGAAFYLWD IGVKRGDIRL       240
     LGVGSYAAPV LSTLILVAAG YAPATLSLAL ACGLIVAGAL VATRAGAEKR ERVA             294
//

If you have problems or comments...

PBIL Back to PBIL home page