(data stored in ACNUC7421 zone)

EMBL: CP001349.PE441

CP001349.PE441       Location/Qualifiers
FT   CDS             506554..507201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0451"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: met:M446_2016
FT                   2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55493"
FT                   /db_xref="GOA:B8ICA5"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA5"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ACL55493.1"
FT                   /translation="MIELAPGLVQHPGYLGPAAQAALAAELARVIDEAPPFTPTMPRTA
FT                   KPFSVQMTNCGPLGWVSDRAGYRYQPHHPETGRPWPPIPAALLAAWDDLVGFPHPPEAC
FT                   LVNLYAPGSRMGLHQDRDEAEFAAPVLSLSLGATAIFRYGGLRRGDPTRSIRLRGGDAL
FT                   VIGGASRLIFHGIDRIVAEPPDLLAAPLLPQAVPPGGRLNLTLRRVSAARPA"
     MIELAPGLVQ HPGYLGPAAQ AALAAELARV IDEAPPFTPT MPRTAKPFSV QMTNCGPLGW        60
     VSDRAGYRYQ PHHPETGRPW PPIPAALLAA WDDLVGFPHP PEACLVNLYA PGSRMGLHQD       120
     RDEAEFAAPV LSLSLGATAI FRYGGLRRGD PTRSIRLRGG DALVIGGASR LIFHGIDRIV       180
     AEPPDLLAAP LLPQAVPPGG RLNLTLRRVS AARPA                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page