(data stored in ACNUC7421 zone)

EMBL: CP001349.PE442

CP001349.PE442       Location/Qualifiers
FT   CDS             507279..508223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55494"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA6"
FT                   /inference="similar to AA sequence:KEGG:M446_2015"
FT                   /protein_id="ACL55494.1"
FT                   /translation="MSLRVLAALLASLVLSGAALAAEPVYPPGSRFGFEPIQDMQISRR
FT                   FTGFERPGGGATVSVVELPPQDYAALTASFTAESLKAQGLTVKNREELTLGDNRKGILF
FT                   TGEQPIEQPGAPTIAKWVLLIADPTVTGLVIGQTLPGAETDEAMRKMLTSVRVRAALTL
FT                   DQQVAALPFRVTETAGFRPVRVLAGNSVLYTAGPKDQMMNLDQPILVLAEAVQPPLPAE
FT                   QRDAFAKAALYSNQTMKDFAIERSQIFRQGGADWHELVARATDIPSGMPVVVSQTIRFK
FT                   PDGYFRAVGVVKAQDRDSVLPRFRQVVDAVQFP"
     MSLRVLAALL ASLVLSGAAL AAEPVYPPGS RFGFEPIQDM QISRRFTGFE RPGGGATVSV        60
     VELPPQDYAA LTASFTAESL KAQGLTVKNR EELTLGDNRK GILFTGEQPI EQPGAPTIAK       120
     WVLLIADPTV TGLVIGQTLP GAETDEAMRK MLTSVRVRAA LTLDQQVAAL PFRVTETAGF       180
     RPVRVLAGNS VLYTAGPKDQ MMNLDQPILV LAEAVQPPLP AEQRDAFAKA ALYSNQTMKD       240
     FAIERSQIFR QGGADWHELV ARATDIPSGM PVVVSQTIRF KPDGYFRAVG VVKAQDRDSV       300
     LPRFRQVVDA VQFP                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page