(data stored in ACNUC7421 zone)

EMBL: CP001349.PE443

CP001349.PE443       Location/Qualifiers
FT   CDS             complement(508211..509926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0453"
FT                   /product="dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: met:M446_1318 dihydroxy-acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55495"
FT                   /db_xref="GOA:B8ICA7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA7"
FT                   /inference="protein motif:PFAM:PF00920"
FT                   /protein_id="ACL55495.1"
FT                   /translation="MSKGLRKGLTSYGDAGFSLFLRKAFIKAMGYSDDALNRPIVGITN
FT                   TYSDYNPCHGNGPALVEAAKRGVMLAGAMPMVFPTISIHESFAHPTSMFLRNLMAMDTE
FT                   EMIRAQPMDAVIVIGGCDKTLPAQIMAAASVDLPTVVIPVGPMVVGHHKGEVLGACTDC
FT                   RRLWAAHRAGAIDEQEIEMVNGRLAPSVGTCMVMGTASTMACLTEAMGLSLPLSATIPA
FT                   PHAERVRLAEASGRRAAEMAVAGGPRPSAILTPAAFRNAQTVLQAIGGSTNGLIHLTAI
FT                   ARRVRAEIDLDAFDAIGRAVPVLVDLKPSGDHYMEHFHHAGGVPRLLAELGDLIDLDVP
FT                   TVAGEKLRDVVAAAEIVPGQTVIRSPADPIKPTGGLAVLRGNLAPRGALIKHAAASERL
FT                   LQHTGRALVFESIPEMAARIDDPDLDVSPDDVLVLCNAGPKGAPGMPEAGYLPIPKKLA
FT                   RQGVKDMVRISDARMSGTAFGTIVLHVTPESAVGGPLALVRTGDRIRLDVAGRRIDLLV
FT                   DEAELARRAAALPAPPRPAWAERGYARLFHDTVTQADEGCDFDFMRPGGAAQGN"
     MSKGLRKGLT SYGDAGFSLF LRKAFIKAMG YSDDALNRPI VGITNTYSDY NPCHGNGPAL        60
     VEAAKRGVML AGAMPMVFPT ISIHESFAHP TSMFLRNLMA MDTEEMIRAQ PMDAVIVIGG       120
     CDKTLPAQIM AAASVDLPTV VIPVGPMVVG HHKGEVLGAC TDCRRLWAAH RAGAIDEQEI       180
     EMVNGRLAPS VGTCMVMGTA STMACLTEAM GLSLPLSATI PAPHAERVRL AEASGRRAAE       240
     MAVAGGPRPS AILTPAAFRN AQTVLQAIGG STNGLIHLTA IARRVRAEID LDAFDAIGRA       300
     VPVLVDLKPS GDHYMEHFHH AGGVPRLLAE LGDLIDLDVP TVAGEKLRDV VAAAEIVPGQ       360
     TVIRSPADPI KPTGGLAVLR GNLAPRGALI KHAAASERLL QHTGRALVFE SIPEMAARID       420
     DPDLDVSPDD VLVLCNAGPK GAPGMPEAGY LPIPKKLARQ GVKDMVRISD ARMSGTAFGT       480
     IVLHVTPESA VGGPLALVRT GDRIRLDVAG RRIDLLVDEA ELARRAAALP APPRPAWAER       540
     GYARLFHDTV TQADEGCDFD FMRPGGAAQG N                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page