(data stored in ACNUC7421 zone)

EMBL: CP001349.PE444

CP001349.PE444       Location/Qualifiers
FT   CDS             510181..510411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55496"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA8"
FT                   /inference="similar to AA sequence:KEGG:M446_2014"
FT                   /protein_id="ACL55496.1"
FT                   /translation="MLALAPALETTARPDSPRVLVESLIPVLDGMFGLDRSGVFPEEIA
FT                   SLLAQLDPGDWETGRGTDVKAGTAEFLAVED"
     MLALAPALET TARPDSPRVL VESLIPVLDG MFGLDRSGVF PEEIASLLAQ LDPGDWETGR        60
     GTDVKAGTAE FLAVED                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page