(data stored in ACNUC7421 zone)

EMBL: CP001349.PE445

CP001349.PE445       Location/Qualifiers
FT   CDS             511130..511813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55497"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA9"
FT                   /inference="similar to AA sequence:KEGG:M446_2012"
FT                   /protein_id="ACL55497.1"
FT                   /translation="MKSSSILAAVTLLLAAPPAFSQGTAEQRAACTPDVWRLCASAIPN
FT                   VGAITSCLRRESANLSPACRTVMNEVQGPAQRVESAQRVAPARPEAPQRMATRRQEPPR
FT                   IAVHPAPVRRTLAARPAPRMMTPRQAPVRLTMRRHYARTAMVRHPAVHAATPRRHYAVR
FT                   SPRRDYAGIPAGFARFGGSRSAMREANYWMRQISGMMGGMGGMGGMSLDSIRDMRVGDL
FT                   MNMME"
     MKSSSILAAV TLLLAAPPAF SQGTAEQRAA CTPDVWRLCA SAIPNVGAIT SCLRRESANL        60
     SPACRTVMNE VQGPAQRVES AQRVAPARPE APQRMATRRQ EPPRIAVHPA PVRRTLAARP       120
     APRMMTPRQA PVRLTMRRHY ARTAMVRHPA VHAATPRRHY AVRSPRRDYA GIPAGFARFG       180
     GSRSAMREAN YWMRQISGMM GGMGGMGGMS LDSIRDMRVG DLMNMME                     227
//

If you have problems or comments...

PBIL Back to PBIL home page