(data stored in ACNUC7421 zone)

EMBL: CP001349.PE447

CP001349.PE447       Location/Qualifiers
FT   CDS             512244..513281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0457"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: met:M446_2010 Mg2 transporter protein CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55499"
FT                   /db_xref="GOA:B8ICB1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB1"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ACL55499.1"
FT                   /translation="MATPTATPRLLCDEPALPGLLFAMVFDETGRGRLVRHDEEVPAPG
FT                   SFGEGFLWLHLNLADARIEGLIAEGRLGPPRLASSAFARDEHQRIAVEGGFVGGVVADL
FT                   AREEAATKPNPAGRLHFVMGPRFLVSGRRHPVVGPDRTRQAAAEGETITAPVRLLESLV
FT                   GHVVGAMAATGAALSDELDAIEDHILDEAVRDERRRLGPIRRDAVRLHRQLLGLRAAFH
FT                   RFEEEGEAEGLPDREVATAARIAQRLDSLDRDMLAMAERSRLLQEEFAARLAEQSNRQL
FT                   FTLSVLTALFLPPTLVTGVFGMNTKGLFLSDFEEGSTIALALAVASALAVYLVIRSLGL
FT                   RTPRR"
     MATPTATPRL LCDEPALPGL LFAMVFDETG RGRLVRHDEE VPAPGSFGEG FLWLHLNLAD        60
     ARIEGLIAEG RLGPPRLASS AFARDEHQRI AVEGGFVGGV VADLAREEAA TKPNPAGRLH       120
     FVMGPRFLVS GRRHPVVGPD RTRQAAAEGE TITAPVRLLE SLVGHVVGAM AATGAALSDE       180
     LDAIEDHILD EAVRDERRRL GPIRRDAVRL HRQLLGLRAA FHRFEEEGEA EGLPDREVAT       240
     AARIAQRLDS LDRDMLAMAE RSRLLQEEFA ARLAEQSNRQ LFTLSVLTAL FLPPTLVTGV       300
     FGMNTKGLFL SDFEEGSTIA LALAVASALA VYLVIRSLGL RTPRR                       345
//

If you have problems or comments...

PBIL Back to PBIL home page